Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human TNFSF12/APO3L Antibody (SAA0806)

  • ARO-A15414-50
  • Validated ELISA

Original price was: $414.00.Current price is: $324.00.

50ug 22% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human TNFSF12/APO3L Antibody (SAA0806)

Product name ARO-A15414-100
Uniprot ID O43508
Raw Antigen Sequence MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15414
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF12/APO3L
Clone Name SAA0806
Protein Name TNFSF12/APO3L
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15414-1MG
Uniprot ID O43508
Raw Antigen Sequence MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15414
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF12/APO3L
Clone Name SAA0806
Protein Name TNFSF12/APO3L
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15414-50
Uniprot ID O43508
Raw Antigen Sequence MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15414
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF12/APO3L
Clone Name SAA0806
Protein Name TNFSF12/APO3L
Target species Anti-Human Monoclonal Antibody

Anti-Human TNFSF12/APO3L Antibody (SAA0806) binds to Human TNFSF12 recombinant protein in ELISA Assay

Anti-Human TNFSF12/APO3L Antibody (SAA0806) binds to Human TNFSF12 recombinant protein in ELISA Assay

Human TNFSF12 recombinant protein(cat. No.PX-P6489) at 0.5µg/mL (100µL/well) can bind Anti-Human TNFSF12/APO3L Antibody (SAA0806) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human TNFSF12/APO3L Antibody (SAA0806)

There are no reviews yet.

Be the first to review “Anti-Human TNFSF12/APO3L Antibody (SAA0806)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products