Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human TUT4 Polyclonal Antibody

  • ARO-A12520-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $171.00.Current price is: $140.00.

50ug 18% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human TUT4 Polyclonal Antibody

Product name ARO-A12520-100
Uniprot ID Q5TAX3
Raw Antigen Sequence ESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPPPSPAHLAALSVAVIELAKEHGITD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-TUTase 4, KIAA0191, TUT4, ZCCHC11, Terminal uridylyltransferase 4, Zinc finger CCHC domain-containing protein 11
Reference ARO-A12520
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human TUT4 (Glu246-Asp370).
Product name ARO-A12520-1MG
Uniprot ID Q5TAX3
Raw Antigen Sequence ESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPPPSPAHLAALSVAVIELAKEHGITD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-TUTase 4, KIAA0191, TUT4, ZCCHC11, Terminal uridylyltransferase 4, Zinc finger CCHC domain-containing protein 11
Reference ARO-A12520
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human TUT4 (Glu246-Asp370).
Product name ARO-A12520-50
Uniprot ID Q5TAX3
Raw Antigen Sequence ESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPPPSPAHLAALSVAVIELAKEHGITD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-TUTase 4, KIAA0191, TUT4, ZCCHC11, Terminal uridylyltransferase 4, Zinc finger CCHC domain-containing protein 11
Reference ARO-A12520
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human TUT4 (Glu246-Asp370).

There are no reviews yet.

Be the first to review “Anti-Human TUT4 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products