Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti LGR5 Polyclonal Antibody

  • ARO-A11514-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $193.00.Current price is: $140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti LGR5 Polyclonal Antibody

Product name ARO-A11514-100
Uniprot ID O75473
Raw Antigen Sequence KGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFV
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-G-protein coupled receptor 49, G-protein coupled receptor HG38, LGR5, GPR67, GPR49, G-protein coupled receptor 67, Leucine-rich repeat-containing G-protein coupled receptor 5
Reference ARO-A11514
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human LGR5 (Lys107-Val296).
Product name ARO-A11514-1MG
Uniprot ID O75473
Raw Antigen Sequence KGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFV
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-G-protein coupled receptor 49, G-protein coupled receptor HG38, LGR5, GPR67, GPR49, G-protein coupled receptor 67, Leucine-rich repeat-containing G-protein coupled receptor 5
Reference ARO-A11514
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human LGR5 (Lys107-Val296).
Product name ARO-A11514-50
Uniprot ID O75473
Raw Antigen Sequence KGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFV
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-G-protein coupled receptor 49, G-protein coupled receptor HG38, LGR5, GPR67, GPR49, G-protein coupled receptor 67, Leucine-rich repeat-containing G-protein coupled receptor 5
Reference ARO-A11514
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human LGR5 (Lys107-Val296).

Anti LGR5 Polyclonal Antibody binds to Human LGR5-GPR49 recombinant protein in WB Assay

Anti LGR5 Polyclonal Antibody binds to Human LGR5-GPR49 recombinant protein in WB Assay

Human LGR5-GPR49 recombinant protein(cat. No.PX-P6246) can bind Anti LGR5 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti LGR5 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products