Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse CD3E Antibody (145-2C11)

  • ARO-A15721-50
  • Validated ELISA

Original price was: $405.00.Current price is: $326.00.

50ug 20% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse CD3E Antibody (145-2C11)

Product name ARO-A15721-100
Uniprot ID P22646
Raw Antigen Sequence MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15721
Isotype IgG
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name 145-2C11
Protein Name CD3E
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15721-1MG
Uniprot ID P22646
Raw Antigen Sequence MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15721
Isotype IgG
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name 145-2C11
Protein Name CD3E
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15721-50
Uniprot ID P22646
Raw Antigen Sequence MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15721
Isotype IgG
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name 145-2C11
Protein Name CD3E
Target species Anti-Mouse Monoclonal Antibody

SEC-HPLC of Anti-Mouse CD3E Antibody (145-2C11)

SEC-HPLC of Anti-Mouse CD3E Antibody (145-2C11)

Anti-Mouse CD3E Antibody (145-2C11)was analyzed by size exclusion chromatography with UV detection.

Anti-Mouse CD3E Antibody (145-2C11)

There are no reviews yet.

Be the first to review “Anti-Mouse CD3E Antibody (145-2C11)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products