Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse CD79b Antibody (HM79-16)

  • ARO-A15671-50
  • Validated FC

Original price was: $347.00.Current price is: $284.00.

50ug 18% OFF + 284 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse CD79b Antibody (HM79-16)

Product name ARO-A15671-100
Uniprot ID P15530
Raw Antigen Sequence MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15671
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79b
Clone Name HM79-16
Protein Name CD79b
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15671-1MG
Uniprot ID P15530
Raw Antigen Sequence MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15671
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79b
Clone Name HM79-16
Protein Name CD79b
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15671-50
Uniprot ID P15530
Raw Antigen Sequence MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15671
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79b
Clone Name HM79-16
Protein Name CD79b
Target species Anti-Mouse Monoclonal Antibody

Flow Cytometry results for Anti-Mouse CD79b Antibody (HM79-16)

Flow Cytometry results for Anti-Mouse CD79b Antibody (HM79-16)

Target Cells were stained with an irrelevant antibody or Anti-Mouse CD79b Antibody (HM79-16) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Mouse CD79b Antibody (HM79-16)

There are no reviews yet.

Be the first to review “Anti-Mouse CD79b Antibody (HM79-16)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products