Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse LGALS3 Antibody (P3)

Original price was: $395.00.Current price is: $324.00.

50ug 18% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse LGALS3 Antibody (P3)

Product name ARO-A15612-100
Uniprot ID P16110
Raw Antigen Sequence MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rabbit
Reference ARO-A15612
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LGALS3
Clone Name P3
Protein Name LGALS3
Target species Anti-Human, Mouse, Rabbit Monoclonal Antibody
Product name ARO-A15612-1MG
Uniprot ID P16110
Raw Antigen Sequence MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rabbit
Reference ARO-A15612
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LGALS3
Clone Name P3
Protein Name LGALS3
Target species Anti-Human, Mouse, Rabbit Monoclonal Antibody
Product name ARO-A15612-50
Uniprot ID P16110
Raw Antigen Sequence MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rabbit
Reference ARO-A15612
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LGALS3
Clone Name P3
Protein Name LGALS3
Target species Anti-Human, Mouse, Rabbit Monoclonal Antibody

SDS-PAGE for Anti-Mouse LGALS3 Antibody (P3)

SDS-PAGE for Anti-Mouse LGALS3 Antibody (P3)

Anti-Mouse LGALS3 Antibody (P3), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Mouse LGALS3 Antibody (P3)

There are no reviews yet.

Be the first to review “Anti-Mouse LGALS3 Antibody (P3)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products