Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)

  • ARO-A15643-50
  • Validated WB

Original price was: $395.00.Current price is: $326.00.

50ug 17% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)

Product name ARO-A15643-100
Uniprot ID Q64253
Raw Antigen Sequence MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15643
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LY6E/SCA-2
Clone Name 9B12.v12
Protein Name LY6E/SCA-2
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15643-1MG
Uniprot ID Q64253
Raw Antigen Sequence MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15643
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LY6E/SCA-2
Clone Name 9B12.v12
Protein Name LY6E/SCA-2
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15643-50
Uniprot ID Q64253
Raw Antigen Sequence MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15643
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen LY6E/SCA-2
Clone Name 9B12.v12
Protein Name LY6E/SCA-2
Target species Anti-Human, Mouse Monoclonal Antibody

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) binds to Mouse LY6E recombinant protein in WB Assay

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) binds to Mouse LY6E recombinant protein in WB Assay

Mouse LY6E recombinant protein(cat. No.PX-P6501) can bind Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12) in Western Blot Assay as detected on gel analysis.

Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)

There are no reviews yet.

Be the first to review “Anti-Mouse LY6E/SCA-2 Antibody (9B12.v12)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products