Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-NPPA Polyclonal antibody

  • ARO-A13537-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $189.00.Current price is: $140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-NPPA Polyclonal antibody

Product name ARO-A13537-100
Uniprot ID P01160
Raw Antigen Sequence ANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cardiodilatin,Pro atrial natriuretic factor 1-30,ANF 3-33,proANP,Atrial natriuretic factor prohormone,ANF 1-33,URO,LANH,proANP 31-67,Atrial natriuretic factor,Atrial natriuretic factor 8-33,VSDL,Atriopeptin I,CDD-ANF,ANF 8-33,Atrial natriuretic peptide prohormone,preproCDD-ANF,KP,CDD 95-126,Atrial natriuretic factor 3-33,Pro atrial natriuretic factor 99-126,Atrial natriuretic factor 1-33,proANP 95-126,proANF 99-126,proANF 79-98,Pro atrial natriuretic factor 31-67,ANP,Atriopeptin III,Alpha-hANP,Pro atrial natriuretic peptide 79-98,ANF,preproANP,Atriopeptin II,PND,Pro atrial natriuretic peptide 95-126,Natriuretic peptides A,Pro atrial natriuretic peptide 1-30,CDD-ANP (95-126),proANP 79-98,Pro atrial natriuretic factor 79-98,Atriopeptigen,proANF,CDD,proANF 1-30,LANP,CDD-ANP (99-126),Pro atrial natriuretic peptide 31-67,NPPA,Alpha-atrial natriuretic peptide,proANF 31-67,Cardionatrin,Long-acting natriuretic hormone,proANP 1-30,
Reference ARO-A13537
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human NPPA (Ala25-Arg123).
Product name ARO-A13537-1MG
Uniprot ID P01160
Raw Antigen Sequence ANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cardiodilatin,Pro atrial natriuretic factor 1-30,ANF 3-33,proANP,Atrial natriuretic factor prohormone,ANF 1-33,URO,LANH,proANP 31-67,Atrial natriuretic factor,Atrial natriuretic factor 8-33,VSDL,Atriopeptin I,CDD-ANF,ANF 8-33,Atrial natriuretic peptide prohormone,preproCDD-ANF,KP,CDD 95-126,Atrial natriuretic factor 3-33,Pro atrial natriuretic factor 99-126,Atrial natriuretic factor 1-33,proANP 95-126,proANF 99-126,proANF 79-98,Pro atrial natriuretic factor 31-67,ANP,Atriopeptin III,Alpha-hANP,Pro atrial natriuretic peptide 79-98,ANF,preproANP,Atriopeptin II,PND,Pro atrial natriuretic peptide 95-126,Natriuretic peptides A,Pro atrial natriuretic peptide 1-30,CDD-ANP (95-126),proANP 79-98,Pro atrial natriuretic factor 79-98,Atriopeptigen,proANF,CDD,proANF 1-30,LANP,CDD-ANP (99-126),Pro atrial natriuretic peptide 31-67,NPPA,Alpha-atrial natriuretic peptide,proANF 31-67,Cardionatrin,Long-acting natriuretic hormone,proANP 1-30,
Reference ARO-A13537
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human NPPA (Ala25-Arg123).
Product name ARO-A13537-50
Uniprot ID P01160
Raw Antigen Sequence ANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cardiodilatin,Pro atrial natriuretic factor 1-30,ANF 3-33,proANP,Atrial natriuretic factor prohormone,ANF 1-33,URO,LANH,proANP 31-67,Atrial natriuretic factor,Atrial natriuretic factor 8-33,VSDL,Atriopeptin I,CDD-ANF,ANF 8-33,Atrial natriuretic peptide prohormone,preproCDD-ANF,KP,CDD 95-126,Atrial natriuretic factor 3-33,Pro atrial natriuretic factor 99-126,Atrial natriuretic factor 1-33,proANP 95-126,proANF 99-126,proANF 79-98,Pro atrial natriuretic factor 31-67,ANP,Atriopeptin III,Alpha-hANP,Pro atrial natriuretic peptide 79-98,ANF,preproANP,Atriopeptin II,PND,Pro atrial natriuretic peptide 95-126,Natriuretic peptides A,Pro atrial natriuretic peptide 1-30,CDD-ANP (95-126),proANP 79-98,Pro atrial natriuretic factor 79-98,Atriopeptigen,proANF,CDD,proANF 1-30,LANP,CDD-ANP (99-126),Pro atrial natriuretic peptide 31-67,NPPA,Alpha-atrial natriuretic peptide,proANF 31-67,Cardionatrin,Long-acting natriuretic hormone,proANP 1-30,
Reference ARO-A13537
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human NPPA (Ala25-Arg123).

Anti-NPPA Polyclonal antibody binds to Recombinant Human NPPA, N-GST in WB Assay

Anti-NPPA Polyclonal antibody binds to Recombinant Human NPPA, N-GST in WB Assay

Recombinant Human NPPA, N-GST(cat. No.ARO-P14195) can bind Anti-NPPA Polyclonal antibody in Western Blot Assay as detected on gel analysis.

Anti-NPPA Polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-NPPA Polyclonal antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products