Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-NSP9 polyclonal antibody

  • PTXCOV-A562-50
  • Validated WB
Note:
For research use and in vitro diagnostic only. Not suitable for human use.

Original price was: $180.00.Current price is: $140.00.

50ug 22% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-NSP9 polyclonal antibody in WB Assay
Anti-NSP9 polyclonal antibody

Anti-NSP9 polyclonal antibody

Product name PTXCOV-A562-100
Uniprot ID P0DTD1
Source P0DTC1
Species SARS-CoV-2
Raw Antigen Sequence NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA
Molecular weight 13kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms Non-structural protein 9
Size 100ug
Reference PTXCOV-A562
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant SARS-CoV-2 NSP9(Asn4141-Gln4253)
Product name PTXCOV-A562-1MG
Uniprot ID P0DTD1
Source P0DTC1
Species SARS-CoV-2
Raw Antigen Sequence NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA
Molecular weight 13kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms Non-structural protein 9
Size 100ug
Reference PTXCOV-A562
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant SARS-CoV-2 NSP9(Asn4141-Gln4253)
Product name PTXCOV-A562-50
Uniprot ID P0DTD1
Source P0DTC1
Species SARS-CoV-2
Raw Antigen Sequence NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQA
Molecular weight 13kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms Non-structural protein 9
Size 100ug
Reference PTXCOV-A562
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant SARS-CoV-2 NSP9(Asn4141-Gln4253)

Anti-NSP9 polyclonal antibody in WB Assay

Anti-NSP9 polyclonal antibody in WB Assay

Anti-NSP9 polyclonal antibody can bind to its target in Western Blot Assay as detected on gel analysis.

Anti-NSP9 polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-NSP9 polyclonal antibody”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products