Brand: ProteoGenix

Anti-ORF8 protein polyclonal antibody

PTXCOV-A560
Quality Chart

Note:: For research use and in vitro diagnostic only. Not suitable for human use.

$201.00

100ug + 201 loyalty points

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Anti-ORF8 protein polyclonal antibody

Product name	Anti-ORF8 protein polyclonal antibody
Source	P0DTC8
Species	SARS-CoV-2
Molecular weight	13kDa
Buffer	PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form	Liquid
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term; -20°c or -80°C for long term
Brand	Proteogenix
Host species	Rabbit
Aliases – Synonyms	Non-structural protein 8
Size	100ug
Reference	PTXCOV-A560
Note	For research use and in vitro diagnostic only. Not suitable for human use.
Isotype	IgG
Clonality	Polyclonal Antibody
Target	ORF8: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

There are no reviews yet.

Be the first to review “Anti-ORF8 protein polyclonal antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-ORF8 protein polyclonal antibody

Anti-ORF8 protein polyclonal antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-ORF8 protein polyclonal antibody

Specifications Anti-ORF8 protein polyclonal antibody

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-ORF8 protein polyclonal antibody