Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

  • ARO-A15068-50
  • Validated ELISA WB

Original price was: $411.00.Current price is: $326.00.

50ug 21% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

Product name ARO-A15068-100
Uniprot ID P43214
Raw Antigen Sequence MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A15068
Isotype IgE
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A15068-1MG
Uniprot ID P43214
Raw Antigen Sequence MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A15068
Isotype IgE
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A15068-50
Uniprot ID P43214
Raw Antigen Sequence MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A15068
Isotype IgE
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2) binds to Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His in WB Assay

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2) binds to Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His in WB Assay

Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His(cat. No.ARO-P15607) can bind Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

SDS-PAGE for Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

There are no reviews yet.

Be the first to review “Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products