Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-PHLPI/Allergen Phl p I Antibody (SAA0681)

Original price was: $614.00.Current price is: $462.00.

100ug 25% OFF + 462 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-PHLPI/Allergen Phl p I Antibody (SAA0681)
Anti-PHLPI/Allergen Phl p I Antibody (SAA0681)

Anti-PHLPI/Allergen Phl p I Antibody (SAA0681)

Product name ARO-A14770-100
Uniprot ID P43213
Raw Antigen Sequence MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14770
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen PHLPI, Pollen allergen Phl p 1, Allergen Phl p I
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A14770-1MG
Uniprot ID P43213
Raw Antigen Sequence MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14770
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen PHLPI, Pollen allergen Phl p 1, Allergen Phl p I
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A14770-50
Uniprot ID P43213
Raw Antigen Sequence MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14770
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen PHLPI, Pollen allergen Phl p 1, Allergen Phl p I
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody

SDS-PAGE for Anti-PHLPI/Allergen Phl p I Antibody (SAA0681)

SDS-PAGE for Anti-PHLPI/Allergen Phl p I Antibody (SAA0681)

Anti-PHLPI/Allergen Phl p I Antibody (SAA0681), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-PHLPI/Allergen Phl p I Antibody (SAA0681)

There are no reviews yet.

Be the first to review “Anti-PHLPI/Allergen Phl p I Antibody (SAA0681)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products