Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-PITRM1 Polyclonal antibody

  • ARO-A13755-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $194.00.Current price is: $140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-PITRM1 Polyclonal antibody

Product name ARO-A13755-100
Uniprot ID Q5JRX3
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Pitrilysin metalloproteinase 1,hMP1,MP1,Metalloprotease 1,PREP,KIAA1104,Presequence protease,mitochondrial,PITRM1,hPreP,
Reference ARO-A13755
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human PITRM1 (Leu544-Ser806).
Product name ARO-A13755-1MG
Uniprot ID Q5JRX3
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Pitrilysin metalloproteinase 1,hMP1,MP1,Metalloprotease 1,PREP,KIAA1104,Presequence protease,mitochondrial,PITRM1,hPreP,
Reference ARO-A13755
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human PITRM1 (Leu544-Ser806).
Product name ARO-A13755-50
Uniprot ID Q5JRX3
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Pitrilysin metalloproteinase 1,hMP1,MP1,Metalloprotease 1,PREP,KIAA1104,Presequence protease,mitochondrial,PITRM1,hPreP,
Reference ARO-A13755
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human PITRM1 (Leu544-Ser806).

Anti-PITRM1 Polyclonal antibody binds to Recombinant Human PITRM1, N-His in WB Assay

Anti-PITRM1 Polyclonal antibody binds to Recombinant Human PITRM1, N-His in WB Assay

Recombinant Human PITRM1, N-His(cat. No.ARO-P13307) can bind Anti-PITRM1 Polyclonal antibody in Western Blot Assay as detected on gel analysis.

Anti-PITRM1 Polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-PITRM1 Polyclonal antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products