Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PITRM1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5JRX3
Molecular weight:
31.74 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Leu544–Ser806
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PITRM1, N-His

Product name ARO-P13307-100
Uniprot ID Q5JRX3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Molecular weight 31.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu544-Ser806
Aliases /Synonyms Pitrilysin metalloproteinase 1, hMP1, MP1, Metalloprotease 1, PREP, KIAA1104, Presequence protease, mitochondrial, PITRM1, hPreP
Reference ARO-P13307
Note For research use only.
Molecular Constructor
Leu544–Ser806
Product name ARO-P13307-1MG
Uniprot ID Q5JRX3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Molecular weight 31.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu544-Ser806
Aliases /Synonyms Pitrilysin metalloproteinase 1, hMP1, MP1, Metalloprotease 1, PREP, KIAA1104, Presequence protease, mitochondrial, PITRM1, hPreP
Reference ARO-P13307
Note For research use only.
Molecular Constructor
Leu544–Ser806
Product name ARO-P13307-50
Uniprot ID Q5JRX3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRS
Molecular weight 31.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu544-Ser806
Aliases /Synonyms Pitrilysin metalloproteinase 1, hMP1, MP1, Metalloprotease 1, PREP, KIAA1104, Presequence protease, mitochondrial, PITRM1, hPreP
Reference ARO-P13307
Note For research use only.
Molecular Constructor
Leu544–Ser806

Title: Introduction to Recombinant Human PITRM1

Recombinant Human PITRM1, also known as Presequence Protease, is a protein that plays a crucial role in the maintenance of mitochondrial function. It is a member of the M16 metallopeptidase family and is involved in the degradation of presequences of precursor proteins targeted to the mitochondria. In this article, we will explore the structure, activity, and application of Recombinant Human PITRM1.

Title: Structure of Recombinant Human PITRM1

Recombinant Human PITRM1 is a 100 kDa protein that contains 912 amino acids. It is composed of three domains: an N-terminal mitochondrial targeting sequence, a central catalytic domain, and a C-terminal domain. The catalytic domain is responsible for the proteolytic activity of PITRM1, while the C-terminal domain is involved in protein-protein interactions.

The catalytic domain of PITRM1 contains a highly conserved metallopeptidase motif, HEXXH, which is responsible for the hydrolysis of peptide bonds. This domain also contains a zinc-binding site, which is essential for the catalytic activity of PITRM1. The C-terminal domain of PITRM1 contains a coiled-coil motif, which is involved in the formation of homo-oligomers.

Title: Activity of Recombinant Human PITRM1

Recombinant Human PITRM1 is a highly specific protease that cleaves presequences of precursor proteins targeted to the mitochondria. It recognizes and cleaves peptides with a presequence motif of -[R/K]-[F/Y]-[L/I/V]-[K/R]-[H/Q]-[L/I/V]-[S/A]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-[L/I/V]-[L/I/V]-[A/G]-

Recombinant Human PITRM1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PITRM1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products