Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ACVRL1/ALK-1 Protein, N-SUMO & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P37023
Molecular weight:
22.92 kDa

Original price was: $505.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Asp22–Gln118
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ACVRL1/ALK-1 Protein, N-SUMO & C-His

Product name ARO-P10855-100
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 22.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10855
Note For research use only.
Molecular Constructor
Asp22–Gln118
Product name ARO-P10855-1MG
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 22.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10855
Note For research use only.
Molecular Constructor
Asp22–Gln118
Product name ARO-P10855-50
Uniprot ID P37023
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 22.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp22-Gln118
Aliases /Synonyms Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I, ACVRL1, ACVRLK1, ALK1
Reference ARO-P10855
Note For research use only.
Molecular Constructor
Asp22–Gln118

Introduction

Recombinant Human ACVRL1/ALK-1 Protein is a type of recombinant protein that plays a crucial role in various biological processes. This protein is also known as Activin Receptor-Like Kinase 1 (ALK-1) and is encoded by the ACVRL1 gene. It belongs to the TGF-beta receptor family and is involved in the regulation of cell growth, differentiation, and angiogenesis. In this article, we will discuss the structure, activity, and application of Recombinant Human ACVRL1/ALK-1 Protein.

Structure of Recombinant Human ACVRL1/ALK-1 Protein

Recombinant Human ACVRL1/ALK-1 Protein is a transmembrane protein that consists of 503 amino acids. It has an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains a ligand-binding site and two cysteine-rich domains, while the intracellular domain has a serine/threonine kinase domain. The transmembrane domain connects the extracellular and intracellular domains and helps in signal transduction.

Activity of Recombinant Human ACVRL1/ALK-1 Protein

Recombinant Human ACVRL1/ALK-1 Protein plays a crucial role in the TGF-beta signaling pathway. It acts as a receptor for TGF-beta ligands, including TGF-beta1, TGF-beta2, and TGF-beta3. Upon binding of the ligand, the extracellular domain of Recombinant Human ACVRL1/ALK-1 Protein undergoes conformational changes, resulting in the activation of the intracellular kinase domain. This, in turn, leads to the phosphorylation of downstream signaling molecules, such as SMAD proteins, which regulate gene expression and cellular processes.

One of the main functions of Recombinant Human ACVRL1/ALK-1 Protein is its role in angiogenesis, the formation of new blood vessels. It is expressed in endothelial cells, which line the inner surface of blood vessels, and plays a crucial role in their development and maintenance. Recombinant Human ACVRL1/ALK-1 Protein also regulates the proliferation and migration of endothelial cells, which are essential for the formation of new blood vessels.

Application of Recombinant Human ACVRL1/ALK-1 Protein

Recombinant Human ACVRL1/ALK-1 Protein has various applications in both research and therapeutic settings. It is commonly used in in vitro studies to investigate the role of TGF-beta signaling in different cellular processes. Recombinant Human ACVRL1/ALK-1 Protein is also used in drug discovery and development, as it is a potential target for the treatment of various diseases, such as cancer and cardiovascular diseases.

In addition, Recombinant Human ACVRL1/ALK-1 Protein has therapeutic applications in the treatment of hereditary hemorrhagic telangiectasia (HHT). HHT is a genetic disorder that affects blood vessels and can lead to severe bleeding and organ damage. Recombinant Human ACVRL1/ALK-1 Protein has been shown to be effective in reducing the severity of nosebleeds, a common symptom of HHT, and has potential for further development as a treatment for this disease.

Conclusion

Recombinant Human ACVRL1/ALK-1 Protein is a crucial protein involved in the TGF-beta signaling pathway and plays a significant role in angiogenesis. Its structure, activity, and various applications make it an essential protein in both research and therapeutic settings. Further studies on Recombinant Human ACVRL1/ALK-1 Protein may lead to the development of new treatments for diseases such as HHT and provide a better understanding of the role of TGF-beta signaling in various biological processes.

Recombinant Human ACVRL1/ALK-1 Protein, N-SUMO & C-His

There are no reviews yet.

Be the first to review “Recombinant Human ACVRL1/ALK-1 Protein, N-SUMO & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products