Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-SREBF1/SREBP1 Polyclonal antibody

  • ARO-A13988-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $186.00.Current price is: $140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-SREBF1/SREBP1 Polyclonal antibody

Product name ARO-A13988-100
Uniprot ID P36956
Raw Antigen Sequence EDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Sterol regulatory element-binding protein 1,SREBF1,BHLHD1,Transcription factor SREBF1,Sterol regulatory element-binding transcription factor 1,Class D basic helix-loop-helix protein 1,bHLHd1,SREBP-1,SREBP1,
Reference ARO-A13988
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human SREBF1 / SREBP1 (Glu30-Leu490).
Product name ARO-A13988-1MG
Uniprot ID P36956
Raw Antigen Sequence EDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Sterol regulatory element-binding protein 1,SREBF1,BHLHD1,Transcription factor SREBF1,Sterol regulatory element-binding transcription factor 1,Class D basic helix-loop-helix protein 1,bHLHd1,SREBP-1,SREBP1,
Reference ARO-A13988
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human SREBF1 / SREBP1 (Glu30-Leu490).
Product name ARO-A13988-50
Uniprot ID P36956
Raw Antigen Sequence EDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Sterol regulatory element-binding protein 1,SREBF1,BHLHD1,Transcription factor SREBF1,Sterol regulatory element-binding transcription factor 1,Class D basic helix-loop-helix protein 1,bHLHd1,SREBP-1,SREBP1,
Reference ARO-A13988
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human SREBF1 / SREBP1 (Glu30-Leu490).

The Anti-SREBF1/SREBP1 polyclonal antibody is designed for the detection of Sterol Regulatory Element-Binding Protein 1, a transcription factor involved in lipid metabolism and cellular regulation.

This antibody enables researchers to analyze protein expression and investigate metabolic pathways related to lipid biosynthesis and cellular homeostasis in various experimental models.

Biological Background

Sterol Regulatory Element-Binding Protein 1 is a key regulator of genes involved in:

  • lipid synthesis
  • fatty acid metabolism
  • cellular metabolic processes

It is widely studied in research areas such as:

  • metabolic regulation
  • lipid homeostasis
  • cellular signaling pathways

Applications

This antibody is suitable for research applications including:

Related Services

Anti-SREBF1/SREBP1 Polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-SREBF1/SREBP1 Polyclonal antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products