Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)

Note:
For research use only. Not suitable for human use.

$452.00

100ug + 452 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)
Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)

Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)

Product name Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)
Uniprot ID Q9KMA6
Raw Antigen Sequence MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLTIYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Toxin HigB-2, anti-higB-2, anti-VC_A0468
Reference ARO-A16234
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen higB-2
Clone Name SAA1174
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)

SDS-PAGE for Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)

Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)

There are no reviews yet.

Be the first to review “Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1174)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products