Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Apitegromab Biosimilar – Anti-pro-GDF-8 mAb – Research Grade

Isotype:
IgG4, lambda

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade

Product name Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade
Uniprot ID O14793
Species Homo Sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Apitegromab,,pro-GDF-8,anti-pro-GDF-8
Reference PX-TA1810
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Lambda
Clonality Monoclonal Antibody
Product name Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade
Uniprot ID O14793
Species Homo Sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Apitegromab,,pro-GDF-8,anti-pro-GDF-8
Reference PX-TA1810
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Lambda
Clonality Monoclonal Antibody
Product name PX-TA1810-50
Uniprot ID O14793
Species Homo Sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Apitegromab,,pro-GDF-8,anti-pro-GDF-8
Reference PX-TA1810
Note For research use only. Not suitable for human use.
Isotype IgG4, lambda

Introduction

Apitegromab Biosimilar, also known as Anti-pro-GDF-8 mAb, is a research grade antibody that has shown promising potential as a therapeutic agent for various diseases. In this article, we will delve into the structure, activity, and potential applications of Apitegromab Biosimilar.

Structure of Apitegromab Biosimilar

Apitegromab Biosimilar is a monoclonal antibody that specifically targets and binds to pro-GDF-8, also known as myostatin. It is a fully humanized antibody, meaning it is derived from human cells and has a high affinity for its target. The antibody is composed of two heavy chains and two light chains, connected by disulfide bonds. The variable regions of the antibody are responsible for its specificity and binding to pro-GDF-8, while the constant regions provide stability and effector functions.

Activity of Apitegromab Biosimilar

The main activity of Apitegromab Biosimilar is the inhibition of pro-GDF-8, a protein that plays a crucial role in regulating muscle growth and function. Pro-GDF-8 is a member of the transforming growth factor-beta (TGF-β) superfamily and is predominantly expressed in skeletal muscle. It acts as a negative regulator of muscle growth by inhibiting the proliferation and differentiation of muscle cells. By binding to pro-GDF-8, Apitegromab Biosimilar blocks its activity and allows for increased muscle growth and function.

Applications of Apitegromab Biosimilar

Apitegromab Biosimilar has shown potential in various therapeutic applications, particularly in the treatment of muscle-related disorders. One of the most promising areas of application is in the treatment of muscular dystrophies, a group of genetic disorders characterized by progressive muscle weakness and degeneration. By inhibiting pro-GDF-8, Apitegromab Biosimilar can potentially promote muscle growth and improve muscle function in individuals with muscular dystrophies.

In addition, Apitegromab Biosimilar has also shown potential in the treatment of sarcopenia, a condition characterized by age-related loss of muscle mass and strength. By targeting pro-GDF-8, Apitegromab Biosimilar can potentially prevent or reverse the muscle loss associated with sarcopenia.

Furthermore, Apitegromab Biosimilar has shown promise in the treatment of cachexia, a condition characterized by severe muscle wasting and weight loss. Cachexia is commonly seen in patients with cancer, chronic obstructive pulmonary disease (COPD), and other chronic diseases. By inhibiting pro-GDF-8, Apitegromab Biosimilar can potentially prevent muscle wasting and improve the quality of life in these patients.

Conclusion

In conclusion, Apitegromab Biosimilar is a research grade antibody that has shown promising potential as a therapeutic agent in various muscle-related disorders. Its specific targeting and inhibition of pro-GDF-8 make it a promising candidate for the treatment of muscular dystrophies, sarcopenia, and cachexia. Further research and clinical trials are needed to fully understand the potential of Apitegromab Biosimilar and its role in improving muscle growth and function.

SDS-PAGE for Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade

SDS-PAGE for Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade

Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Apitegromab Biosimilar - Anti-pro-GDF-8 mAb - Research Grade

  • Sakellariou, P., Walpurgis, K., Thomas, A. et al. Combined detection of inhibitors of the activin receptor signaling pathways (IASPs) by means of LC-HRMS/MS for human doping control. Sci Rep 15, 19887 (2025). https://doi.org/10.1038/s41598-025-03562-y

There are no reviews yet.

Be the first to review “Apitegromab Biosimilar – Anti-pro-GDF-8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products