Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brentuximab Biosimilar – Anti-TNFRSF8 mAb – Research Grade

  • PX-TA1621-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

Product name Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade
Uniprot ID P28908
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Brentuximab,0,TNFRSF8,anti-TNFRSF8
Reference PX-TA1621
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human IgG1
Clonality Monoclonal Antibody
Product name Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade
Uniprot ID P28908
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Brentuximab,0,TNFRSF8,anti-TNFRSF8
Reference PX-TA1621
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human IgG1
Clonality Monoclonal Antibody
Product name PX-TA1621-50
Uniprot ID P28908
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Brentuximab,0,TNFRSF8,anti-TNFRSF8
Reference PX-TA1621
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Brentuximab Biosimilar: A Powerful Anti-TNFRSF8 Monoclonal Antibody for

Cancer Therapy

Brentuximab biosimilar, also known as anti-TNFRSF8 mAb, is a monoclonal antibody that has shown great promise in the treatment of cancer. This biosimilar is a highly specific and potent therapeutic agent that targets TNFRSF8, a cell surface receptor that is overexpressed in various types of cancer. In this article, we will delve into the structure, mechanism of action, and potential applications of this powerful antibody.

Structure of Brentuximab Biosimilar

Brentuximab biosimilar is a chimeric monoclonal antibody, meaning it is composed of both human and mouse components. It is made up of two parts – the constant region, which is derived from human antibodies, and the variable region, which is derived from mouse antibodies. This unique structure allows Brentuximab biosimilar to bind specifically to TNFRSF8 on cancer cells, while also minimizing the risk of immune reactions in patients.

The antibody has a molecular weight of approximately 148 kDa and is composed of two heavy chains and two light chains. The heavy chain consists of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chain consists of one constant region (CL) and one variable region (VL). The variable regions are responsible for binding to TNFRSF8, while the constant regions play a role in immune system activation and antibody effector functions.

Mechanism of Action Brentuximab biosimilar exerts its anti-

cancer effects by targeting and binding to TNFRSF8, a cell surface receptor that is overexpressed in various types of cancer, including Hodgkin lymphoma, cutaneous T-cell lymphoma, and B-cell lymphoma. TNFRSF8 is involved in promoting cancer cell growth, survival, and proliferation, making it an attractive therapeutic target.

When Brentuximab biosimilar binds to TNFRSF8, it triggers a cascade of events that ultimately leads to cancer cell death. The antibody can induce apoptosis (programmed cell death) in cancer cells, inhibit cell proliferation, and promote immune-mediated killing of cancer cells. This multi-faceted mechanism of action makes Brentuximab biosimilar a highly effective and versatile anti- cancer agent.

Applications of Brentuximab Biosimilar

Brentuximab biosimilar is currently approved for the treatment of relapsed or refractory Hodgkin lymphoma and systemic anaplastic large cell lymphoma. However, ongoing research is exploring its potential for use in other types of cancer, including non-Hodgkin lymphoma, multiple myeloma, and solid tumors.

Additionally, Brentuximab biosimilar is being studied in combination with other anti- cancer therapies, such as chemotherapy and radiation, to enhance its effectiveness. It has also shown promising results in combination with checkpoint inhibitors, a type of immunotherapy that helps the immune system recognize and attack cancer cells.

Furthermore, Brentuximab biosimilar is being investigated for its potential use in the treatment of autoimmune diseases, such as rheumatoid arthritis and psoriasis, as TNFRSF8 has been implicated in the pathogenesis of these conditions.

Conclusion

Brentuximab biosimilar is a highly specific and potent monoclonal antibody that targets TNFRSF8, a cell surface receptor that is overexpressed in various types of cancer. Its unique structure and mechanism of action make it a promising therapeutic agent for the treatment of cancer, with potential applications in other diseases as well. Ongoing research and clinical trials will continue to uncover the full potential of this powerful antibody in the fight against cancer.

SDS-PAGE for Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

SDS-PAGE for Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

Flow Cytometry results for Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

There are no reviews yet.

Be the first to review “Brentuximab Biosimilar – Anti-TNFRSF8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products