Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD226 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q15762
Molecular weight:
40-50kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Met1–Asn247 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD226 Recombinant Protein

Product name PX-P4126-100
Uniprot ID Q15762
Uniprot link http://www.uniprot.org/uniprot/Q15762
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Molecular weight 40-50kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn247
Aliases /Synonyms DNAM1
Reference PX-P4126
Note For research use only
Molecular Constructor
Met1–Asn247 His
Product name PX-P4126-1MG
Uniprot ID Q15762
Uniprot link http://www.uniprot.org/uniprot/Q15762
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Molecular weight 40-50kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn247
Aliases /Synonyms DNAM1
Reference PX-P4126
Note For research use only
Molecular Constructor
Met1–Asn247 His
Product name PX-P4126-50
Uniprot ID Q15762
Uniprot link http://www.uniprot.org/uniprot/Q15762
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Molecular weight 40-50kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn247
Aliases /Synonyms DNAM1
Reference PX-P4126
Note For research use only
Molecular Constructor
Met1–Asn247 His

General information on CD226 Recombinant Protein:

The cluster of differentiation system (CD) is commonly used as a cell marker for immunophenotyping. Different types of cells in the immune system can be identified by surface CD molecules related to cellular immune function. More than 32 unique CD groups and subcategories have been identified. Some CD molecules act as important receptors or ligands for cells, starting a signal cascade and then altering the cell’s behavior. Some CD proteins are not involved in the cell signaling process, but have other functions, such as cell incorporation. CD226, also known as PTA1 or DNAM-1, is a member of the immunoglobulin superfamily, which contains two Ig-like domains from group V. A high rate of CD226 (differentiation cluster 226) has been found on the surface of natural lethal cells, platelets, monocytes and some T cells. CD226 has binding sites for CD112 and CD155 and mediates cell adhesion to other cells containing their ligands.

CD226 Recombinant Protein

There are no reviews yet.

Be the first to review “CD226 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products