Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD254 / RANKL / TNFSF11, N-Fc, recombinant protein

  • PX-P5597
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14788
Molecular weight:
48.32 kDa

$500.00

100ug + 500 loyalty points
Fc Gly136–Asp317
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD254 / RANKL / TNFSF11, N-Fc, recombinant protein

Product name CD254 / RANKL / TNFSF11, N-Fc, recombinant protein
Uniprot ID O14788
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Molecular weight 48.32 kDa
Protein delivered with Tag? N-terminal Fc Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly136-Asp317
Protein Accession O14788
Reference PX-P5597
Note For research use only.
Molecular Constructor
Fc Gly136–Asp317

Denosumab Biosimilar – Anti-RANKL mAb – Research Grade binds to CD254 / RANKL / TNFSF11, N-Fc, recombinant protein in indirect ELISA Assay

Denosumab Biosimilar – Anti-RANKL mAb – Research Grade binds to CD254 / RANKL / TNFSF11, N-Fc, recombinant protein in indirect ELISA Assay

Immobilized CD254 / RANKL / TNFSF11, N-Fc, recombinant protein (cat. No.PX-P5597) at 5µg/mL (100µL/well) can bind to Denosumab Biosimilar- Anti-RANKL mAb- Research Grade (cat. No.PX-TA1018) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

CD254 / RANKL / TNFSF11, N-Fc, recombinant protein

There are no reviews yet.

Be the first to review “CD254 / RANKL / TNFSF11, N-Fc, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products