Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD40 Recombinant Protein |
|---|---|
| Uniprot ID | P25942 |
| Uniprot link | http://www.uniprot.org/uniprot/P25942 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Molecular weight | 22.32kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Arg193 |
| Aliases /Synonyms | TNFRSF5 |
| Reference | PX-P4082 |
| Note | For research use only |
CD40, also known as TNFRSF5, is a member of the TNF receptor superfamily, which is a single transmembrane glycoprotein. The CD40 protein plays a vital role in mediating a variety of immune and inflammatory responses, including the change in class T that depends on the type of immunoglobulin, the development of B cell memory and the formation of reproductive centers. The CD40 protein is expressed in B cells, dendritic cells, macrophages, endothelial cells and some tumor cells. CD40 deficiency can lead to high IgM type 3 (HIGM3) immunodeficiency. In addition, β-amyloid-induced microglia activation requires CD40 / CD40L interaction and is therefore considered an early event in the pathogenesis of Alzheimer’s disease.
Immobilized CD40 Recombinant Protein (cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind to Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb (cat. No.PX-TA1503) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Send us a message from the form below
Reviews
There are no reviews yet.