Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD40 Recombinant Protein |
---|---|
Uniprot ID | P25942 |
Uniprot link | http://www.uniprot.org/uniprot/P25942 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
Molecular weight | 22.32kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1~Arg193 |
Aliases /Synonyms | TNFRSF5 |
Reference | PX-P4082 |
Note | For research use only |
CD40, also known as TNFRSF5, is a member of the TNF receptor superfamily, which is a single transmembrane glycoprotein. The CD40 protein plays a vital role in mediating a variety of immune and inflammatory responses, including the change in class T that depends on the type of immunoglobulin, the development of B cell memory and the formation of reproductive centers. The CD40 protein is expressed in B cells, dendritic cells, macrophages, endothelial cells and some tumor cells. CD40 deficiency can lead to high IgM type 3 (HIGM3) immunodeficiency. In addition, β-amyloid-induced microglia activation requires CD40 / CD40L interaction and is therefore considered an early event in the pathogenesis of Alzheimer’s disease.
Send us a message from the form below
Reviews
There are no reviews yet.