Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Giloralimab Biosimilar – Anti-CD40 mAb – Research Grade

  • PX-TA1845-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Giloralimab Biosimilar - Anti-CD40 mAb - Research Grade

Product name Giloralimab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Species Homo Sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Giloralimab,,CD40,anti-CD40
Reference PX-TA1845
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Giloralimab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Species Homo Sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Giloralimab,,CD40,anti-CD40
Reference PX-TA1845
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1845-50
Uniprot ID P25942
Species Homo Sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Giloralimab,,CD40,anti-CD40
Reference PX-TA1845
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Giloralimab Biosimilar, also known as Anti-CD40 mAb, is a novel therapeutic antibody that targets the CD40 protein. This protein is a member of the tumor necrosis factor receptor superfamily and is expressed on various immune cells, including B cells, dendritic cells, and macrophages. Giloralimab Biosimilar has shown promising results in preclinical studies and is currently being developed as a potential treatment for various autoimmune diseases and cancer. In this article, we will discuss the structure, activity, and potential applications of this novel antibody.

Structure of Giloralimab Biosimilar

Giloralimab Biosimilar is a monoclonal antibody, meaning it is produced by a single clone of cells. It is designed to target the CD40 protein, which is located on the surface of immune cells. The antibody has a Y-shaped structure, with two identical heavy chains and two identical light chains. These chains are connected by disulfide bonds, forming a stable structure. The heavy chains contain a variable region that is responsible for binding to the CD40 protein, while the constant region determines the antibody’s effector functions.

Mechanism of Action

Giloralimab Biosimilar works by binding to the CD40 protein on immune cells, specifically the CD40L binding site. This prevents the interaction between CD40 and its ligand, CD40L, which is crucial for the activation and differentiation of immune cells. By blocking this interaction, Giloralimab Biosimilar inhibits the activation of B cells, dendritic cells, and macrophages, leading to a decrease in pro-inflammatory cytokines and an increase in anti-inflammatory cytokines. This mechanism of action makes Giloralimab Biosimilar a potential treatment for autoimmune diseases, where an overactive immune response is the underlying cause.

Potential Applications

Giloralimab Biosimilar is currently being studied for its potential use in various autoimmune diseases, including rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis. In preclinical studies, this antibody has shown promising results in reducing inflammation and improving disease symptoms. It is also being investigated as a potential treatment for cancer, as CD40 is known to play a role in tumor growth and immune evasion. By targeting CD40, Giloralimab Biosimilar may help activate immune responses against cancer cells and improve the efficacy of other cancer treatments.

Research Grade

Giloralimab Biosimilar is currently in the research stage, with preclinical studies being conducted to evaluate its safety and efficacy. This means that the antibody is not yet approved for clinical use and is only available for research purposes. However, the promising results from these studies have led to the initiation of clinical trials, which will determine the safety and efficacy of Giloralimab Biosimilar in humans. If successful, this antibody has the potential to become a valuable treatment option for various diseases.

Conclusion

Giloralimab Biosimilar, also known as Anti-CD40 mAb, is a novel therapeutic antibody that targets the CD40 protein on immune cells. It works by blocking the interaction between CD40 and its ligand, leading to a decrease in pro-inflammatory cytokines and an increase in anti-inflammatory cytokines. This mechanism of action makes Giloralimab Biosimilar a potential treatment for autoimmune diseases and cancer. While still in the research stage, this antibody has shown promising results in preclinical studies and is currently being evaluated in clinical trials. If approved, Giloralimab Biosimilar has the potential to become a valuable treatment option for various diseases.

Flow Cytometry results for Giloralimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow Cytometry results for Giloralimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow-cytometry using APC anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD40 monoclonal antibody (Catalog: PX-TA1845, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Giloralimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow Cytometry results for Giloralimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow-cytometry using FITC anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CD40 monoclonal antibody (Catalog: PX-TA1845, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Giloralimab Biosimilar - Anti-CD40 mAb - Research Grade

There are no reviews yet.

Be the first to review “Giloralimab Biosimilar – Anti-CD40 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products