Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Crefmirlimab Biosimilar – Anti-CD8A mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade

Product name Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade
Uniprot ID P01732
Species scFv Engineered Dimer
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Crefmirlimab,,CD8A,anti-CD8A
Reference PX-TA1828
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade
Uniprot ID P01732
Species scFv Engineered Dimer
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Crefmirlimab,,CD8A,anti-CD8A
Reference PX-TA1828
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1828-50
Uniprot ID P01732
Species scFv Engineered Dimer
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Crefmirlimab,,CD8A,anti-CD8A
Reference PX-TA1828
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Crefmirlimab Biosimilar, also known as Anti-CD8A mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of various diseases. This biosimilar is designed to target the CD8A protein, which plays a crucial role in the immune response. In this article, we will discuss the structure, activity, and potential applications of Crefmirlimab Biosimilar.

Structure of Crefmirlimab Biosimilar

Crefmirlimab Biosimilar is a recombinant humanized monoclonal antibody that is produced in Chinese hamster ovary (CHO) cells. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the CD8A protein, while the constant region is responsible for mediating effector functions.

Activity of Crefmirlimab Biosimilar

Crefmirlimab Biosimilar specifically targets the CD8A protein, which is expressed on the surface of cytotoxic T cells. This protein plays a key role in the activation and function of T cells, which are important components of the immune system. By binding to CD8A, Crefmirlimab Biosimilar blocks its interaction with other proteins, thereby inhibiting T cell activation and proliferation. This can potentially lead to a decrease in inflammation and autoimmune responses.

In addition, Crefmirlimab Biosimilar has been shown to have a potent anti-tumor activity. CD8A is also expressed on the surface of tumor-infiltrating lymphocytes (TILs), which are immune cells that infiltrate tumors and play a crucial role in anti-tumor immunity. By targeting CD8A, Crefmirlimab Biosimilar can enhance the function of TILs and promote tumor cell death, leading to a potential anti- cancer effect.

Applications of Crefmirlimab Biosimilar

Crefmirlimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various diseases. One potential application of this biosimilar is in the treatment of autoimmune diseases such as psoriasis, rheumatoid arthritis, and multiple sclerosis. By targeting CD8A, Crefmirlimab Biosimilar can suppress the activity of T cells and reduce inflammation, which is a key feature of these diseases.

In addition, Crefmirlimab Biosimilar may have potential in the treatment of various types of cancer. Clinical trials are currently ongoing to evaluate its efficacy in different types of cancer, including melanoma, non-small cell lung cancer, and ovarian cancer. By targeting CD8A, Crefmirlimab Biosimilar can enhance the anti-tumor activity of TILs and potentially improve the response to other cancer treatments.

Conclusion

In summary, Crefmirlimab Biosimilar is a promising therapeutic agent that specifically targets the CD8A protein. Its unique mechanism of action makes it a potential treatment option for various diseases, including autoimmune diseases and cancer. Further research and clinical trials are needed to fully understand the potential of this biosimilar and its role in improving patient outcomes.

SDS-PAGE for Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade

SDS-PAGE for Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade

Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade

There are no reviews yet.

Be the first to review “Crefmirlimab Biosimilar – Anti-CD8A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products