Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lucatumumab Biosimilar – Anti-CD40 mAb – Research Grade

  • PX-TA1130-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Product name Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Source CAS 903512-50-5
Species Homo sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lucatumumab,CHIR-12,12,HCD122,CD40,anti-CD40
Reference PX-TA1130
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Source CAS 903512-50-5
Species Homo sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lucatumumab,CHIR-12,12,HCD122,CD40,anti-CD40
Reference PX-TA1130
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1130-50
Uniprot ID P25942
Source CAS 903512-50-5
Species Homo sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lucatumumab,CHIR-12,12,HCD122,CD40,anti-CD40
Reference PX-TA1130
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Lucatumumab Biosimilar, also known as Anti-CD40 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for various diseases. This biosimilar is a research grade version of the original drug, and is being studied for its structure, activity, and potential applications in the field of immunotherapy. In this article, we will explore the structure, activity, and potential applications of Lucatumumab Biosimilar in detail.

Structure of Lucatumumab Biosimilar

Lucatumumab Biosimilar is a monoclonal antibody that specifically targets the CD40 protein. The CD40 protein is a cell surface receptor that is expressed on various immune cells, including B cells, dendritic cells, and macrophages. It plays a crucial role in regulating immune responses and is involved in the activation and proliferation of immune cells.

The structure of Lucatumumab Biosimilar is similar to that of the original drug, with minor differences due to the biosimilar development process. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy and light chains are further divided into constant and variable regions, with the variable regions being responsible for the specific binding to the CD40 protein.

Activity of Lucatumumab Biosimilar

Lucatumumab Biosimilar acts by binding to the CD40 protein on immune cells, leading to the activation of downstream signaling pathways. This results in the activation and proliferation of immune cells, which can then mount an effective immune response against pathogens or cancer cells.

One of the key activities of Lucatumumab Biosimilar is its ability to enhance the function of immune cells, such as B cells and dendritic cells. This can lead to an increased production of antibodies and improved antigen presentation, respectively. Additionally, Lucatumumab Biosimilar has been shown to induce the production of cytokines, which are important signaling molecules that regulate immune responses.

Applications of Lucatumumab Biosimilar

Lucatumumab Biosimilar has been studied for its potential applications in various diseases, particularly in the field of cancer immunotherapy. As CD40 is overexpressed on many cancer cells, Lucatumumab Biosimilar has the potential to specifically target and kill cancer cells, while sparing healthy cells.

Clinical trials have shown promising results for Lucatumumab Biosimilar in the treatment of various cancers, including lymphoma, multiple myeloma, and solid tumors. It has also been studied in combination with other cancer therapies, such as chemotherapy and immune checkpoint inhibitors, to improve treatment outcomes.

Apart from

cancer, Lucatumumab Biosimilar has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and lupus. By modulating the immune response, Lucatumumab Biosimilar can help alleviate symptoms and improve disease outcomes in these conditions.

Conclusion

In conclusion, Lucatumumab Biosimilar is a research grade version of the original drug, Anti-CD40 mAb, which has shown promising results in the field of immunotherapy. Its structure, activity, and potential applications make it a promising candidate for the treatment of various diseases, particularly cancer and autoimmune diseases. Further research and clinical trials are needed to fully understand the potential of Lucatumumab Biosimilar and its role in improving patient outcomes.

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow-cytometry using FITC anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CD40 monoclonal antibody (Catalog: PX-TA1130, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade binds to CD40 Recombinant Protein in ELISA Assay

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade binds to CD40 Recombinant Protein in ELISA Assay

CD40 Recombinant Protein(cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

SDS-PAGE for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow-cytometry using APC anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD40 monoclonal antibody (Catalog: PX-TA1130, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow-cytometry using PE anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD40 monoclonal antibody (Catalog: PX-TA1130, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

There are no reviews yet.

Be the first to review “Lucatumumab Biosimilar – Anti-CD40 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products