Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Serrumab Biosimilar – Anti-scorpion venom mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $432.00.Current price is: $308.00.

50ug 29% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Serrumab Biosimilar - Anti-scorpion venom mAb - Research Grade

Product name Serrumab Biosimilar - Anti-scorpion venom mAb - Research Grade
Uniprot ID P15226
Species Homo sapiens
Raw Antigen Sequence MKGMILFISCLLLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKCGKK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-scorpion venom
Reference PX-TA2027
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Serrumab Biosimilar - Anti-scorpion venom mAb - Research Grade
Uniprot ID P15226
Species Homo sapiens
Raw Antigen Sequence MKGMILFISCLLLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKCGKK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-scorpion venom
Reference PX-TA2027
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2027-50
Uniprot ID P15226
Species Homo sapiens
Raw Antigen Sequence MKGMILFISCLLLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKCGKK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-scorpion venom
Reference PX-TA2027
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Serrumab Biosimilar is a monoclonal antibody (mAb) that has been developed as a biosimilar version of the anti-scorpion venom mAb. This biosimilar mAb has been specifically designed to target and neutralize the venom of scorpions, which can cause severe and potentially fatal reactions in humans. In this article, we will discuss the structure, activity, and potential applications of Serrumab Biosimilar as a therapeutic agent.

Structure of Serrumab Biosimilar

Serrumab Biosimilar is a recombinant humanized mAb, meaning that it is produced using recombinant DNA technology and has been modified to resemble a human antibody. It is composed of two heavy chains and two light chains, each with a unique amino acid sequence that determines its specific binding properties. The heavy and light chains are connected by disulfide bonds and form a Y-shaped structure, with the two arms of the Y containing the antigen-binding sites.

Activity of Serrumab Biosimilar

The primary function of Serrumab Biosimilar is to bind to and neutralize the venom of scorpions. This is achieved through its high specificity and affinity for the venom components, which allows it to block the toxic effects of the venom. The binding of Serrumab Biosimilar to the venom prevents it from interacting with its target cells, thereby reducing the severity of the venom’s effects. Additionally, Serrumab Biosimilar can also activate the immune system to produce an immune response against the venom, further enhancing its therapeutic activity.

Applications of Serrumab Biosimilar

Serrumab Biosimilar has potential applications in both the treatment and prevention of scorpion envenomation. As a therapeutic agent, it can be used to treat individuals who have been stung by a scorpion and are experiencing symptoms of envenomation. By neutralizing the venom, Serrumab Biosimilar can alleviate the symptoms and prevent further damage to the body. It can also be used as a preventive measure for individuals who are at high risk of scorpion stings, such as those living in areas with a high prevalence of scorpions.

In addition to its use in human medicine, Serrumab Biosimilar also has potential applications in veterinary medicine. Scorpion envenomation is a common problem in livestock, particularly in regions where scorpions are endemic. Serrumab Biosimilar can be used to protect livestock from the toxic effects of scorpion venom, thereby reducing economic losses and improving animal welfare.

Conclusion

In summary, Serrumab Biosimilar is a recombinant humanized monoclonal antibody that has been developed as a biosimilar version of the anti-scorpion venom mAb. Its structure, activity, and potential applications make it a promising therapeutic agent for the treatment and prevention of scorpion envenomation. Further research and clinical trials are needed to fully evaluate the efficacy and safety of Serrumab Biosimilar, but it has the potential to save lives and improve the quality of life for those at risk of scorpion stings.

SDS-PAGE for Research Grade Serrumab

SDS-PAGE for Research Grade Serrumab

Research Grade Serrumab, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Serrumab Biosimilar - Anti-scorpion venom mAb - Research Grade

There are no reviews yet.

Be the first to review “Serrumab Biosimilar – Anti-scorpion venom mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products