Brand: ProteoGenix

Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

PX-TA1196-50
Validated ELISA FC WB

Clonality:: Monoclonal Antibody
Isotype:: IgG1-nd

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points

Size Size

50ug Original price was: $205.00.Current price is: $167.00.
100ug Original price was: $300.00.Current price is: $238.00.
1MG Original price was: $656.00.Current price is: $482.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name	Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID	P25942
Source	CAS 395639-53-9
Species	Chimeric
Raw Antigen Sequence	MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference	PX-TA1196
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-nd
Clonality	Monoclonal Antibody

Product name	Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID	P25942
Source	CAS 395639-53-9
Species	Chimeric
Raw Antigen Sequence	MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference	PX-TA1196
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-nd
Clonality	Monoclonal Antibody

Product name	PX-TA1196-50
Uniprot ID	P25942
Source	CAS 395639-53-9
Species	Chimeric
Raw Antigen Sequence	MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference	PX-TA1196
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-nd
Clonality	Monoclonal Antibody

General information on Anti-CD40/TNFRSF5(Homo sapiens) (Teneliximab) Monoclonal Antibody

Teneliximab is a chimeric monoclonal antibody that binds to the immunostimulatory protein CD40.

Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

General information on Anti-CD40/TNFRSF5(Homo sapiens) (Teneliximab) Monoclonal Antibody

Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Related products

CD40 ligand(CD40LG)

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Iscalimab ELISA Kit

Anti-Human CD40/TNFRSF5 Monoclonal Antibody (Emory U. anti-CD40)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

Specifications Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Description

General information on Anti-CD40/TNFRSF5(Homo sapiens) (Teneliximab) Monoclonal Antibody

Documents

QC & Validation

Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

3D Representation

Reviews

Related products

CD40 ligand(CD40LG)

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Iscalimab ELISA Kit

Anti-Human CD40/TNFRSF5 Monoclonal Antibody (Emory U. anti-CD40)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade