Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

  • PX-TA1196-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 395639-53-9
Species Chimeric
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1196
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 395639-53-9
Species Chimeric
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1196
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1196-50
Uniprot ID P25942
Source CAS 395639-53-9
Species Chimeric
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1196
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

General information on Anti-CD40/TNFRSF5(Homo sapiens) (Teneliximab) Monoclonal Antibody

Teneliximab is a chimeric monoclonal antibody that binds to the immunostimulatory protein CD40.

Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products