Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lemalesomab Biosimilar – Anti-NCA-90 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lemalesomab Biosimilar - Anti-NCA-90 mAb - Research Grade

Product name Lemalesomab Biosimilar - Anti-NCA-90 mAb - Research Grade
Uniprot ID P40199
Source CAS 250242-54-7
Species Mus musculus
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lemalesomab,78NCA-90, IMMU-MN3,NCA-90 ,anti-NCA-90
Reference PX-TA1200
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Lemalesomab Biosimilar - Anti-NCA-90 mAb - Research Grade
Uniprot ID P40199
Source CAS 250242-54-7
Species Mus musculus
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lemalesomab,78NCA-90, IMMU-MN3,NCA-90 ,anti-NCA-90
Reference PX-TA1200
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1200-50
Uniprot ID P40199
Source CAS 250242-54-7
Species Mus musculus
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lemalesomab,78NCA-90, IMMU-MN3,NCA-90 ,anti-NCA-90
Reference PX-TA1200
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Title: Understanding Lemalesomab Biosimilar – An Anti-NCA-90 mAb for Targeted Therapy

Introduction

Lemalesomab Biosimilar, also known as anti-NCA-90 monoclonal antibody (mAb), is a promising therapeutic agent that has shown potential in the treatment of various diseases. This biosimilar is designed to target NCA-90, a cell surface glycoprotein that is overexpressed in certain cancers and inflammatory conditions. In this article, we will explore the structure, activity, and potential applications of Lemalesomab Biosimilar in detail.

Structure of Lemalesomab Biosimilar

Lemalesomab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, which means it is produced using genetic engineering techniques in a laboratory. It is derived from a mouse mAb, which has been modified to reduce its immunogenicity in humans. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. It has a Y-shaped structure with two antigen binding sites at the ends of the arms, allowing it to bind to NCA-90 with high specificity and affinity.

Activity of Lemalesomab Biosimilar

The primary activity of Lemalesomab Biosimilar is its ability to bind to NCA-90, a glycoprotein that is expressed on the surface of certain cells. NCA-90 is involved in cell adhesion and signaling pathways, and its overexpression has been linked to cancer progression and inflammation. By binding to NCA-90, Lemalesomab Biosimilar can block its activity and inhibit the growth and survival of cancer cells. It can also modulate the immune response by targeting inflammatory cells that express NCA-90.

Applications of Lemalesomab Biosimilar

The potential applications of Lemalesomab Biosimilar are vast, thanks to its ability to target NCA-90, which is implicated in various diseases. One of the most promising applications of this biosimilar is in the treatment of cancer. NCA-90 is overexpressed in several types of cancer, including colorectal, breast, and lung cancer. By targeting NCA-90, Lemalesomab Biosimilar can potentially inhibit tumor growth and improve patient outcomes.

In addition to cancer, Lemalesomab Biosimilar may also have applications in inflammatory conditions such as rheumatoid arthritis and inflammatory bowel disease. NCA-90 is involved in the activation of immune cells, and its inhibition by Lemalesomab Biosimilar can help reduce inflammation and alleviate symptoms in these diseases.

Research Grade Lemalesomab Biosimilar

Lemalesomab Biosimilar is currently available as a research grade product, which means it is intended for use in laboratory research and not for clinical use. This allows scientists to study the mechanism of action and potential therapeutic applications of this biosimilar in various disease models. Research grade Lemalesomab Biosimilar is produced under strict quality control measures to ensure its purity and activity, making it a valuable tool for scientific research.

Conclusion

In conclusion, Lemalesomab Biosimilar is a promising therapeutic agent that targets NCA-90, a cell surface glycoprotein implicated in cancer and inflammatory conditions. Its unique structure and mechanism of action make it a potential candidate for targeted therapy in various diseases. As research on this biosimilar continues, we can expect to see more applications and potential clinical use in the future.

SDS-PAGE for Lemalesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

SDS-PAGE for Lemalesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

Lemalesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lemalesomab Biosimilar - Anti-NCA-90  mAb - Research Grade

There are no reviews yet.

Be the first to review “Lemalesomab Biosimilar – Anti-NCA-90 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products