Brand: ProteoGenix

Bleselumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

PX-TA1393-50
Validated ELISA

Clonality:: Monoclonal Antibody
Isotype:: IgG4, Kappa

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points

Size Size

50ug Original price was: $221.00.Current price is: $167.00.
100ug Original price was: $290.00.Current price is: $238.00.
1MG Original price was: $660.00.Current price is: $482.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name	Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID	P25942
Source	CAS 1453067-91-8
Species	Homo sapiens
Raw Antigen Sequence	MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Bleselumab,4D11,ASKP-1240,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference	PX-TA1393
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG4-kappa
Clonality	Monoclonal Antibody

Product name	Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID	P25942
Source	CAS 1453067-91-8
Species	Homo sapiens
Raw Antigen Sequence	MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Bleselumab,4D11,ASKP-1240,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference	PX-TA1393
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG4-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1393-50
Uniprot ID	P25942
Source	CAS 1453067-91-8
Species	Homo sapiens
Raw Antigen Sequence	MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Bleselumab,4D11,ASKP-1240,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference	PX-TA1393
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG4, Kappa
Clonality	Monoclonal Antibody

General information on Anti-CD40/ TNFRSF5[Homo sapiens] (Bleselumab) Monoclonal Antibody

Bleselumab is investigatedfor the prevention of the Recurrence of Focal Segmental Glomerulosclerosis in case of de Novo Kidney Transplantation.

SDS-PAGE for Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Bleselumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Bleselumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

General information on Anti-CD40/ TNFRSF5[Homo sapiens] (Bleselumab) Monoclonal Antibody

SDS-PAGE for Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Related products

CD40 ligand(CD40LG)

Human IgG4 Isotype Control antibody

Iscalimab ELISA Kit

Anti-Human CD40/TNFRSF5 Monoclonal Antibody (Emory U. anti-CD40)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Bleselumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

Specifications Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Description

General information on Anti-CD40/ TNFRSF5[Homo sapiens] (Bleselumab) Monoclonal Antibody

Documents

QC & Validation

SDS-PAGE for Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

3D Representation

Reviews

Related products

CD40 ligand(CD40LG)

Human IgG4 Isotype Control antibody

Iscalimab ELISA Kit

Anti-Human CD40/TNFRSF5 Monoclonal Antibody (Emory U. anti-CD40)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade