Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Classical swine fever virus (CSFV) CSFV E2 glycoprotein recombinant protein

Host species:
Mammalian cells
Origin species:
Classical swine fever virus (CSFV)
Uniprot ID:
B9VS89
Molecular weight:
67.47 kDa

Original price was: $372.00.Current price is: $330.00.

50ug 11% OFF + 330 loyalty points
Arg1–Asp337 Fc (Pig IgG3)
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Classical swine fever virus (CSFV) CSFV E2 glycoprotein  recombinant protein

Classical swine fever virus (CSFV) CSFV E2 glycoprotein recombinant protein

Product name PX-P6450-100
Uniprot ID B9VS89
Origin species Classical swine fever virus (CSFV)
Expression system Eukaryotic expression
Raw Antigen Sequence RLACKEDYRYAISSTDEIGLLGAGGLTTTWKEYNHDLQLNDGTVKASCVAGSFKVTALNVVSRRYLASLHKKALPTSVTFELLFDGTNPSTEEMGDDFRSGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRRDKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGVVKQCRWCGFDFDGPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISTEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPVMKTSCTFNYTKTLKNRYYEPRDSYFQQYMLKGEYQYWFDLDATDRHSD
Molecular weight 67.47 kDa
Protein delivered with Tag? C-Terminal Fc (Pig IgG3) Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg1-Asp337
Aliases /Synonyms E2, Classical swine fever virus (CSFV)E2 glycoprotein,
Reference PX-P6450
Molecular Constructor
Arg1–Asp337 Fc (Pig IgG3)
Product name PX-P6450-1MG
Uniprot ID B9VS89
Origin species Classical swine fever virus (CSFV)
Expression system Eukaryotic expression
Raw Antigen Sequence RLACKEDYRYAISSTDEIGLLGAGGLTTTWKEYNHDLQLNDGTVKASCVAGSFKVTALNVVSRRYLASLHKKALPTSVTFELLFDGTNPSTEEMGDDFRSGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRRDKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGVVKQCRWCGFDFDGPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISTEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPVMKTSCTFNYTKTLKNRYYEPRDSYFQQYMLKGEYQYWFDLDATDRHSD
Molecular weight 67.47 kDa
Protein delivered with Tag? C-Terminal Fc (Pig IgG3) Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg1-Asp337
Aliases /Synonyms E2, Classical swine fever virus (CSFV)E2 glycoprotein,
Reference PX-P6450
Molecular Constructor
Arg1–Asp337 Fc (Pig IgG3)
Product name PX-P6450-50
Uniprot ID B9VS89
Origin species Classical swine fever virus (CSFV)
Expression system Eukaryotic expression
Raw Antigen Sequence RLACKEDYRYAISSTDEIGLLGAGGLTTTWKEYNHDLQLNDGTVKASCVAGSFKVTALNVVSRRYLASLHKKALPTSVTFELLFDGTNPSTEEMGDDFRSGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRRDKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGVVKQCRWCGFDFDGPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISTEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPVMKTSCTFNYTKTLKNRYYEPRDSYFQQYMLKGEYQYWFDLDATDRHSD
Molecular weight 67.47 kDa
Protein delivered with Tag? C-Terminal Fc (Pig IgG3) Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg1-Asp337
Aliases /Synonyms E2, Classical swine fever virus (CSFV)E2 glycoprotein,
Reference PX-P6450
Molecular Constructor
Arg1–Asp337 Fc (Pig IgG3)

Classical swine fever virus (CSFV) CSFV E2 glycoprotein  recombinant protein

There are no reviews yet.

Be the first to review “Classical swine fever virus (CSFV) CSFV E2 glycoprotein recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products