Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

FMDV Lpro Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Foot-and-mouth disease virus (isolate -/Germany/A5Westerwald/1951 serotype A) (FMDV)
Uniprot ID:
P03307

Original price was: $433.00.Current price is: $387.00.

100ug 11% OFF + 387 loyalty points
His Met1–Lys201
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

FMDV Lpro Recombinant Protein, N-His

Product name ARO-P18632-100
Uniprot ID P03307
Origin species Foot-and-mouth disease virus (isolate -/Germany/A5Westerwald/1951 serotype A) (FMDV)
Expression system Prokaryotic expression
Raw Antigen Sequence MHTTDCFIALVHAIREIRALFLPRTTGKMELTLHNGEKKTFYSRPNNHDNCWLNTILQLFRYVDEPFFDWVYNSPENLTLEAINQLEELTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCMVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEEFYPWTPDPSDVLVFVPYDQEPLNGDWKAMVQRKLK
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys201
Aliases /Synonyms Genome polyprotein, Leader protease, Lpro, EC:3.4.22.46, Capsid protein VP0, VP4-VP2, Capsid protein VP4, P1A, Virion protein 4, Capsid protein VP2, P1B, Virion protein 2, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A, P2A, P52, Protein 2B, P2B, Protein 2C, P2C, EC:3.6.1.15, Protein 3A, P3A, Protein 3B-1, P3B-1, Genome-linked protein VPg1, Protein 3B-2, P3B-2, Genome-linked protein VPg2, Protein 3B-3, P3B-3, Genome-linked protein VPg3, Protease 3C, EC:3.4.22.28, Picornain 3C, P3C, Protease P20B, RNA-directed RNA polymerase 3D-POL, P3D-POL, EC:2.7.7.48, P56A
Reference ARO-P18632
Note For research use only.
Molecular Constructor
His Met1–Lys201
Product name ARO-P18632-1MG
Uniprot ID P03307
Origin species Foot-and-mouth disease virus (isolate -/Germany/A5Westerwald/1951 serotype A) (FMDV)
Expression system Prokaryotic expression
Raw Antigen Sequence MHTTDCFIALVHAIREIRALFLPRTTGKMELTLHNGEKKTFYSRPNNHDNCWLNTILQLFRYVDEPFFDWVYNSPENLTLEAINQLEELTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCMVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEEFYPWTPDPSDVLVFVPYDQEPLNGDWKAMVQRKLK
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys201
Aliases /Synonyms Genome polyprotein, Leader protease, Lpro, EC:3.4.22.46, Capsid protein VP0, VP4-VP2, Capsid protein VP4, P1A, Virion protein 4, Capsid protein VP2, P1B, Virion protein 2, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A, P2A, P52, Protein 2B, P2B, Protein 2C, P2C, EC:3.6.1.15, Protein 3A, P3A, Protein 3B-1, P3B-1, Genome-linked protein VPg1, Protein 3B-2, P3B-2, Genome-linked protein VPg2, Protein 3B-3, P3B-3, Genome-linked protein VPg3, Protease 3C, EC:3.4.22.28, Picornain 3C, P3C, Protease P20B, RNA-directed RNA polymerase 3D-POL, P3D-POL, EC:2.7.7.48, P56A
Reference ARO-P18632
Note For research use only.
Molecular Constructor
His Met1–Lys201
Product name ARO-P18632-50
Uniprot ID P03307
Origin species Foot-and-mouth disease virus (isolate -/Germany/A5Westerwald/1951 serotype A) (FMDV)
Expression system Prokaryotic expression
Raw Antigen Sequence MHTTDCFIALVHAIREIRALFLPRTTGKMELTLHNGEKKTFYSRPNNHDNCWLNTILQLFRYVDEPFFDWVYNSPENLTLEAINQLEELTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCMVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEEFYPWTPDPSDVLVFVPYDQEPLNGDWKAMVQRKLK
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys201
Aliases /Synonyms Genome polyprotein, Leader protease, Lpro, EC:3.4.22.46, Capsid protein VP0, VP4-VP2, Capsid protein VP4, P1A, Virion protein 4, Capsid protein VP2, P1B, Virion protein 2, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A, P2A, P52, Protein 2B, P2B, Protein 2C, P2C, EC:3.6.1.15, Protein 3A, P3A, Protein 3B-1, P3B-1, Genome-linked protein VPg1, Protein 3B-2, P3B-2, Genome-linked protein VPg2, Protein 3B-3, P3B-3, Genome-linked protein VPg3, Protease 3C, EC:3.4.22.28, Picornain 3C, P3C, Protease P20B, RNA-directed RNA polymerase 3D-POL, P3D-POL, EC:2.7.7.48, P56A
Reference ARO-P18632
Note For research use only.
Molecular Constructor
His Met1–Lys201

There are no reviews yet.

Be the first to review “FMDV Lpro Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products