Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Growth/differentiation factor 9(GDF9)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O60383
Molecular weight:
15.49 kDa

Original price was: $177.00.Current price is: $145.00.

100ug 18% OFF + 145 loyalty points
His Gly320–Arg454
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Growth/differentiation factor 9(GDF9)

Product name Growth/differentiation factor 9(GDF9)
Uniprot ID O60383
Uniprot link https://www.uniprot.org/uniprot/O60383
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR
Molecular weight 15.49 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly320-Arg454
Protein Accession O60383
Spec:Entrez GeneID 2661
Spec:NCBI Gene Aliases POF14
Spec:SwissProtID Q4VAW5
NCBI Reference O60383
Aliases /Synonyms GDF-9
Reference PX-P4783
Note For research use only
Molecular Constructor
His Gly320–Arg454
Product name Growth/differentiation factor 9(GDF9)
Uniprot ID O60383
Uniprot link https://www.uniprot.org/uniprot/O60383
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR
Molecular weight 15.49 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly320-Arg454
Protein Accession O60383
Spec:Entrez GeneID 2661
Spec:NCBI Gene Aliases POF14
Spec:SwissProtID Q4VAW5
NCBI Reference O60383
Aliases /Synonyms GDF-9
Reference PX-P4783
Note For research use only
Molecular Constructor
His Gly320–Arg454
Product name PX-P4783-1MG
Uniprot ID O60383
Uniprot link https://www.uniprot.org/uniprot/O60383
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR
Molecular weight 15.49 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly320-Arg454
Protein Accession O60383
Spec:Entrez GeneID 2661
Spec:NCBI Gene Aliases POF14
Spec:SwissProtID Q4VAW5
NCBI Reference O60383
Aliases /Synonyms GDF-9
Reference PX-P4783
Note For research use only
Molecular Constructor
His Gly320–Arg454

Growth/differentiation factor 9(GDF9)

There are no reviews yet.

Be the first to review “Growth/differentiation factor 9(GDF9)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products