Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HHV-8 K2/vIL-6 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus)
Uniprot ID:
Q2HRC7

Original price was: $339.00.Current price is: $271.00.

50ug 20% OFF + 271 loyalty points
Lys23–Lys204 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

HHV-8 K2/vIL-6 Recombinant Protein, C-Fc

Product name ARO-P18603-100
Uniprot ID Q2HRC7
Origin species Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus)
Expression system Eukaryotic expression
Raw Antigen Sequence KLPDAPEFEKDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLNSIPDVTPDVHDK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys23-Lys204
Aliases /Synonyms Viral interleukin-6 homolog; vIL-6; K2
Reference ARO-P18603
Note For research use only.
Molecular Constructor
Lys23–Lys204 Fc
Product name ARO-P18603-1MG
Uniprot ID Q2HRC7
Origin species Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus)
Expression system Eukaryotic expression
Raw Antigen Sequence KLPDAPEFEKDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLNSIPDVTPDVHDK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys23-Lys204
Aliases /Synonyms Viral interleukin-6 homolog; vIL-6; K2
Reference ARO-P18603
Note For research use only.
Molecular Constructor
Lys23–Lys204 Fc
Product name ARO-P18603-50
Uniprot ID Q2HRC7
Origin species Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus)
Expression system Eukaryotic expression
Raw Antigen Sequence KLPDAPEFEKDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLNSIPDVTPDVHDK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys23-Lys204
Aliases /Synonyms Viral interleukin-6 homolog; vIL-6; K2
Reference ARO-P18603
Note For research use only.
Molecular Constructor
Lys23–Lys204 Fc

There are no reviews yet.

Be the first to review “HHV-8 K2/vIL-6 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products