Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HPeV-1 Recombinant Protein 3C, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human parechovirus 1 (HPeV-1)
Uniprot ID:
Q66578

Original price was: $449.00.Current price is: $387.00.

100ug 14% OFF + 387 loyalty points
His Ala1518–Gln1711
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

HPeV-1 Recombinant Protein 3C, N-His

Product name ARO-P18665-100
Uniprot ID Q66578
Origin species Human parechovirus 1 (HPeV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence APYDGQLEHIISQMAYITGSTTGHMTHCAGYQHDEIILHGHSIKYLEQEDELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQ
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1518-Gln1711
Aliases /Synonyms Genome polyprotein, Capsid protein VP0, P1AB, Virion protein 0, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A H-NC, P2A, Protein 2A, Protein 2B, P2B, Protein 2C, P2C, 3.6.1.15, Protein 3A, P3A, Viral protein genome-linked, VPg, Protein 3B, P3B, Protease 3C, P3C, 3.4.22.28, Picornain 3C, RNA-directed RNA polymerase 3D-POL, P3D-POL, 2.7.7.48
Reference ARO-P18665
Note For research use only.
Molecular Constructor
His Ala1518–Gln1711
Product name ARO-P18665-1MG
Uniprot ID Q66578
Origin species Human parechovirus 1 (HPeV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence APYDGQLEHIISQMAYITGSTTGHMTHCAGYQHDEIILHGHSIKYLEQEDELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQ
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1518-Gln1711
Aliases /Synonyms Genome polyprotein, Capsid protein VP0, P1AB, Virion protein 0, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A H-NC, P2A, Protein 2A, Protein 2B, P2B, Protein 2C, P2C, 3.6.1.15, Protein 3A, P3A, Viral protein genome-linked, VPg, Protein 3B, P3B, Protease 3C, P3C, 3.4.22.28, Picornain 3C, RNA-directed RNA polymerase 3D-POL, P3D-POL, 2.7.7.48
Reference ARO-P18665
Note For research use only.
Molecular Constructor
His Ala1518–Gln1711
Product name ARO-P18665-50
Uniprot ID Q66578
Origin species Human parechovirus 1 (HPeV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence APYDGQLEHIISQMAYITGSTTGHMTHCAGYQHDEIILHGHSIKYLEQEDELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQ
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1518-Gln1711
Aliases /Synonyms Genome polyprotein, Capsid protein VP0, P1AB, Virion protein 0, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A H-NC, P2A, Protein 2A, Protein 2B, P2B, Protein 2C, P2C, 3.6.1.15, Protein 3A, P3A, Viral protein genome-linked, VPg, Protein 3B, P3B, Protease 3C, P3C, 3.4.22.28, Picornain 3C, RNA-directed RNA polymerase 3D-POL, P3D-POL, 2.7.7.48
Reference ARO-P18665
Note For research use only.
Molecular Constructor
His Ala1518–Gln1711

There are no reviews yet.

Be the first to review “HPeV-1 Recombinant Protein 3C, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products