Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HTLV-1 Surface protein gp46, C-Fc

Host species:
Mammalian cells
Origin species:
Human T-cell leukemia virus 1 (HTLV-1)
Uniprot ID:
P03381

Original price was: $303.00.Current price is: $271.00.

50ug 11% OFF + 271 loyalty points
Asp21–Arg312 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

HTLV-1 Surface protein gp46, C-Fc

Product name ARO-P18476-100
Uniprot ID P03381
Origin species Human T-cell leukemia virus 1 (HTLV-1)
Expression system Eukaryotic expression
Raw Antigen Sequence DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp21-Arg312
Aliases /Synonyms Envelope glycoprotein gp62, Env polyprotein, Surface protein, SU, Glycoprotein 46, gp46, Transmembrane protein, TM, Glycoprotein 21, gp21, env
Reference ARO-P18476
Note For research use only.
Molecular Constructor
Asp21–Arg312 Fc
Product name ARO-P18476-1MG
Uniprot ID P03381
Origin species Human T-cell leukemia virus 1 (HTLV-1)
Expression system Eukaryotic expression
Raw Antigen Sequence DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp21-Arg312
Aliases /Synonyms Envelope glycoprotein gp62, Env polyprotein, Surface protein, SU, Glycoprotein 46, gp46, Transmembrane protein, TM, Glycoprotein 21, gp21, env
Reference ARO-P18476
Note For research use only.
Molecular Constructor
Asp21–Arg312 Fc
Product name ARO-P18476-50
Uniprot ID P03381
Origin species Human T-cell leukemia virus 1 (HTLV-1)
Expression system Eukaryotic expression
Raw Antigen Sequence DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp21-Arg312
Aliases /Synonyms Envelope glycoprotein gp62, Env polyprotein, Surface protein, SU, Glycoprotein 46, gp46, Transmembrane protein, TM, Glycoprotein 21, gp21, env
Reference ARO-P18476
Note For research use only.
Molecular Constructor
Asp21–Arg312 Fc

There are no reviews yet.

Be the first to review “HTLV-1 Surface protein gp46, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products