Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human AK4/AK3L1 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P27144
Molecular weight:
27.43 kDa

Original price was: $328.00.Current price is: $271.00.

50ug 17% OFF + 271 loyalty points
His Met1–Tyr223
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human AK4/AK3L1 Recombinant Protein, N-His

Product name ARO-P19708-100
Uniprot ID P27144
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Molecular weight 27.43 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr223
Aliases /Synonyms AK3, AK3L1, AK4, Adenylate kinase 3-like, Adenylate kinase 4, mitochondrial, EC:2.7.4.4, EC:2.7.4.6, GTP:AMP phosphotransferase AK4
Reference ARO-P19708
Note For research use only.
Molecular Constructor
His Met1–Tyr223
Product name ARO-P19708-1MG
Uniprot ID P27144
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Molecular weight 27.43 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr223
Aliases /Synonyms AK3, AK3L1, AK4, Adenylate kinase 3-like, Adenylate kinase 4, mitochondrial, EC:2.7.4.4, EC:2.7.4.6, GTP:AMP phosphotransferase AK4
Reference ARO-P19708
Note For research use only.
Molecular Constructor
His Met1–Tyr223
Product name ARO-P19708-50
Uniprot ID P27144
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Molecular weight 27.43 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr223
Aliases /Synonyms AK3, AK3L1, AK4, Adenylate kinase 3-like, Adenylate kinase 4, mitochondrial, EC:2.7.4.4, EC:2.7.4.6, GTP:AMP phosphotransferase AK4
Reference ARO-P19708
Note For research use only.
Molecular Constructor
His Met1–Tyr223

There are no reviews yet.

Be the first to review “Human AK4/AK3L1 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products