Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human AMHR2 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q16671
Molecular weight:
42.26 kDa

Original price was: $488.00.Current price is: $387.00.

100ug 21% OFF + 387 loyalty points
Pro18–Ser144 Fc
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human AMHR2 Recombinant Protein, C-Fc

Human AMHR2 Recombinant Protein, C-Fc

Product name ARO-P20618-100
Uniprot ID Q16671
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
Molecular weight 42.26 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro18-Ser144
Aliases /Synonyms AMH type II receptor, AMHR, AMHR2, Anti-Muellerian hormone type II receptor, Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, MIS type II receptor, MISR2, MISRII, MRII
Reference ARO-P20618
Note For research use only.
Molecular Constructor
Pro18–Ser144 Fc
Product name ARO-P20618-1MG
Uniprot ID Q16671
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
Molecular weight 42.26 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro18-Ser144
Aliases /Synonyms AMH type II receptor, AMHR, AMHR2, Anti-Muellerian hormone type II receptor, Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, MIS type II receptor, MISR2, MISRII, MRII
Reference ARO-P20618
Note For research use only.
Molecular Constructor
Pro18–Ser144 Fc
Product name ARO-P20618-50
Uniprot ID Q16671
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
Molecular weight 42.26 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro18-Ser144
Aliases /Synonyms AMH type II receptor, AMHR, AMHR2, Anti-Muellerian hormone type II receptor, Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, MIS type II receptor, MISR2, MISRII, MRII
Reference ARO-P20618
Note For research use only.
Molecular Constructor
Pro18–Ser144 Fc

There are no reviews yet.

Be the first to review “Human AMHR2 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products