Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human APLNR/APJ Recombinant Protein, N-His Tag

Host species:
Insect cells
Origin species:
Human
Uniprot ID:
P35414
Molecular weight:
50 kDa

Original price was: $575.00.Current price is: $500.00.

100ug 13% OFF + 500 loyalty points
His Met1–Asp380
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human APLNR/APJ Recombinant Protein, N-His Tag

Human APLNR/APJ Recombinant Protein, N-His Tag

Product name PX-P6742-100
Uniprot ID P35414
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
Molecular weight 50 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Met1-Asp380
Aliases /Synonyms G-protein coupled receptor HG11, Apelin receptor, AGTRL1, APJ, Angiotensin receptor-like 1, APLNR, G-protein coupled receptor APJ
Reference PX-P6742
Note For research use only.
Molecular Constructor
His Met1–Asp380
Product name PX-P6742-1MG
Uniprot ID P35414
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
Molecular weight 50 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Met1-Asp380
Aliases /Synonyms G-protein coupled receptor HG11, Apelin receptor, AGTRL1, APJ, Angiotensin receptor-like 1, APLNR, G-protein coupled receptor APJ
Reference PX-P6742
Note For research use only.
Molecular Constructor
His Met1–Asp380
Product name PX-P6742-50
Uniprot ID P35414
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
Molecular weight 50 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Met1-Asp380
Aliases /Synonyms G-protein coupled receptor HG11, Apelin receptor, AGTRL1, APJ, Angiotensin receptor-like 1, APLNR, G-protein coupled receptor APJ
Reference PX-P6742
Note For research use only.
Molecular Constructor
His Met1–Asp380

There are no reviews yet.

Be the first to review “Human APLNR/APJ Recombinant Protein, N-His Tag”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products