Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD132/IL2RG Monoclonal Antibody

Original price was: $487.00.Current price is: $393.00.

100ug 19% OFF + 393 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human CD132/IL2RG Monoclonal Antibody
Human CD132/IL2RG Monoclonal Antibody

Human CD132/IL2RG Monoclonal Antibody

Product name ARO-A16056-100
Uniprot ID P31785 & P24394
Uniprot link P31785
Raw Antigen Sequence MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms p64, Interleukin-2 receptor subunit gamma, gammaC, IL-2 receptor subunit gamma, CD132, IL-2R subunit gamma, IL-2RG, IL2RG, Cytokine receptor common subunit gamma
Reference ARO-A16056
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD132/IL2RG
Clone Name A2
Protein Name CD132/IL2RG
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16056-1MG
Uniprot ID P31785 & P24394
Uniprot link P31785
Raw Antigen Sequence MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms p64, Interleukin-2 receptor subunit gamma, gammaC, IL-2 receptor subunit gamma, CD132, IL-2R subunit gamma, IL-2RG, IL2RG, Cytokine receptor common subunit gamma
Reference ARO-A16056
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD132/IL2RG
Clone Name A2
Protein Name CD132/IL2RG
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16056-50
Uniprot ID P31785 & P24394
Uniprot link P31785
Raw Antigen Sequence MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms p64, Interleukin-2 receptor subunit gamma, gammaC, IL-2 receptor subunit gamma, CD132, IL-2R subunit gamma, IL-2RG, IL2RG, Cytokine receptor common subunit gamma
Reference ARO-A16056
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD132/IL2RG
Clone Name A2
Protein Name CD132/IL2RG
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human CD132/IL2RG Monoclonal Antibody

SDS-PAGE for Human CD132/IL2RG Monoclonal Antibody

Human CD132/IL2RG Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD132/IL2RG Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD132/IL2RG Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products