Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD158i/KIR2DS4 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P43632

Original price was: $433.00.Current price is: $387.00.

100ug 11% OFF + 387 loyalty points
Gln22–His245 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD158i/KIR2DS4 Recombinant Protein, C-Fc

Product name ARO-P18220-100
Uniprot ID P43632
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHL
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gln22-His245
Aliases /Synonyms Killer cell immunoglobulin-like receptor 2DS4, CD158 antigen-like family member I, Natural killer-associated transcript 8, NKAT-8, P58 natural killer cell receptor clones CL-39/CL-17, p58 NK receptor CL-39/CL-17, CD158i, KIR2DS4, CD158I, KKA3, NKAT8
Reference ARO-P18220
Note For research use only.
Molecular Constructor
Gln22–His245 Fc
Product name ARO-P18220-1MG
Uniprot ID P43632
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHL
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gln22-His245
Aliases /Synonyms Killer cell immunoglobulin-like receptor 2DS4, CD158 antigen-like family member I, Natural killer-associated transcript 8, NKAT-8, P58 natural killer cell receptor clones CL-39/CL-17, p58 NK receptor CL-39/CL-17, CD158i, KIR2DS4, CD158I, KKA3, NKAT8
Reference ARO-P18220
Note For research use only.
Molecular Constructor
Gln22–His245 Fc
Product name ARO-P18220-50
Uniprot ID P43632
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHL
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gln22-His245
Aliases /Synonyms Killer cell immunoglobulin-like receptor 2DS4, CD158 antigen-like family member I, Natural killer-associated transcript 8, NKAT-8, P58 natural killer cell receptor clones CL-39/CL-17, p58 NK receptor CL-39/CL-17, CD158i, KIR2DS4, CD158I, KKA3, NKAT8
Reference ARO-P18220
Note For research use only.
Molecular Constructor
Gln22–His245 Fc

SDS-PAGE for Human CD158i/KIR2DS4 Recombinant Protein, C-Fc

SDS-PAGE for Human CD158i/KIR2DS4 Recombinant Protein, C-Fc

Human CD158i/KIR2DS4 Recombinant Protein, C-Fc, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Human CD158i/KIR2DS4 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products