Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD178/FASLG/TNFSF6 Monoclonal Antibody

Original price was: $361.00.Current price is: $275.00.

50ug 24% OFF + 275 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD178/FASLG/TNFSF6 Monoclonal Antibody

Product name ARO-A16050-100
Uniprot ID P48023
Uniprot link P48023
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference ARO-A16050
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD178/FASLG/TNFSF6
Clone Name NOK2/NOK-2
Protein Name CD178/FASLG/TNFSF6
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16050-1MG
Uniprot ID P48023
Uniprot link P48023
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference ARO-A16050
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD178/FASLG/TNFSF6
Clone Name NOK2/NOK-2
Protein Name CD178/FASLG/TNFSF6
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16050-50
Uniprot ID P48023
Uniprot link P48023
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference ARO-A16050
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD178/FASLG/TNFSF6
Clone Name NOK2/NOK-2
Protein Name CD178/FASLG/TNFSF6
Target species Anti-Human Monoclonal Antibody

Human CD178/FASLG/TNFSF6 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD178/FASLG/TNFSF6 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products