Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD20/MS4A1 recombinant protein

  • PX-P6274
  • Validated ELISA
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P11836
Molecular weight:
19.58 kDa

$392.00

100ug + 392 loyalty points
His Trx Tags Ile143–Ser188
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD20/MS4A1 recombinant protein

Product name Human CD20/MS4A1 recombinant protein
Uniprot ID P11836
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS
Molecular weight 19.58 kDa
Protein delivered with Tag? N-Terminal His & N-Terminal Trx Tags
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile143-Ser188
Aliases /Synonyms B-lymphocyte surface antigen B1, Membrane-spanning 4-domains subfamily A member 1, MS4A1, Leukocyte surface antigen Leu-16, B-lymphocyte antigen CD20, Bp35, CD20
Reference PX-P6274
Note For research use only.
Molecular Constructor
His Trx Tags Ile143–Ser188

General information on Human CD20/MS4A1 recombinant protein

Structure of Human CD20/MS4A1 Recombinant Protein

The human CD20/MS4A1 recombinant protein is a type I membrane protein composed of a single extracellular loop, a single transmembrane domain, and a cytoplasmic tail. It is expressed on the surface of B-cells and is involved in B-cell activation and proliferation.

Activity of Human CD20/MS4A1 Recombinant Protein

The activity of the human CD20/MS4A1 recombinant protein is mediated by its interaction with other proteins, such as CD19 and CD21, which are involved in B-cell activation and proliferation. The CD20/MS4A1 protein is also involved in the regulation of B-cell differentiation and maturation.

Application of Human CD20/MS4A1 Recombinant Protein

The human CD20/MS4A1 recombinant protein is a promising target for the development of antibody-drug conjugates for the treatment of B-cell malignancies. Antibodies targeting the CD20/MS4A1 protein have been successfully used in clinical trials, demonstrating their potential as an effective treatment for various B-cell malignancies.

Ocrelizumab Biosimilar - Anti-MS4A1, CD20 mAb binds to Human CD20/MS4A1 recombinant protein in indirect ELISA Assay

Ocrelizumab Biosimilar - Anti-MS4A1, CD20 mAb binds to Human CD20/MS4A1 recombinant protein in indirect ELISA Assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind to Ocrelizumab Biosimilar - Anti-MS4A1, CD20 mAb (cat. No.PX-TA1162) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Ibritumomab Biosimilar - Anti-MS4A1(CD20,MS4A-1) mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Ibritumomab Biosimilar - Anti-MS4A1(CD20,MS4A-1) mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind Ibritumomab Biosimilar - Anti-MS4A1(CD20,MS4A-1) mAb - Research Grade (cat. No.PX-TA1620) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 279.7M.

Obinutuzumab Biosimilar - Anti-MS4A1, CD20 mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Obinutuzumab Biosimilar - Anti-MS4A1, CD20 mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind Obinutuzumab Biosimilar - Anti-MS4A1, CD20 mAb - Research Grade (cat. No.PX-TA1172) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 134.2M.

Mosunetuzumab Biosimilar - Anti-CD3E; MS4A1; CD20 mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Mosunetuzumab Biosimilar - Anti-CD3E; MS4A1; CD20 mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind Mosunetuzumab Biosimilar - Anti-CD3E; MS4A1; CD20 mAb - Research Grade (cat. No.PX-TA1482) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 472.8M.

Ocaratuzumab Biosimilar - Anti-MS4A1, CD20 mAb binds to Human CD20/MS4A1 recombinant protein in indirect ELISA Assay

Ocaratuzumab Biosimilar - Anti-MS4A1, CD20 mAb binds to Human CD20/MS4A1 recombinant protein in indirect ELISA Assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind to Ocaratuzumab Biosimilar - Anti-MS4A1, CD20 mAb (cat. No.PX-TA1298) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human CD20/MS4A1 recombinant protein

There are no reviews yet.

Be the first to review “Human CD20/MS4A1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products