Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD23/FCER2 Recombinant Protein, N-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P06734

Original price was: $480.00.Current price is: $387.00.

100ug 19% OFF + 387 loyalty points
His Asp48–Ser321
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD23/FCER2 Recombinant Protein, N-His

Product name ARO-P17793-100
Uniprot ID P06734
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp48-Ser321
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-P17793
Note For research use only.
Molecular Constructor
His Asp48–Ser321
Product name ARO-P17793-1MG
Uniprot ID P06734
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp48-Ser321
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-P17793
Note For research use only.
Molecular Constructor
His Asp48–Ser321
Product name ARO-P17793-50
Uniprot ID P06734
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp48-Ser321
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-P17793
Note For research use only.
Molecular Constructor
His Asp48–Ser321

There are no reviews yet.

Be the first to review “Human CD23/FCER2 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products