Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD299-CLEC4M recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9H2X3
Molecular weight:
64.83 kDa

$451.00

100ug + 451 loyalty points
Fc Ser78–Glu399
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD299-CLEC4M recombinant protein

Product name Human CD299-CLEC4M recombinant protein
Uniprot ID Q9H2X3
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Molecular weight 64.83 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser78-Glu399
Aliases /Synonyms DC-SIGNR, DC-SIGN2, CLEC4M, DC-SIGN-related protein, C-type lectin domain family 4 member M, CD299, L-SIGN, CD209L, Liver/lymph node-specific ICAM-3-grabbing non-integrin, CD209L1, Dendritic cell-specific ICAM-3-grabbing non-integrin 2, CD209 antigen-like protein 1
Reference PX-P6226
Note For research use only
Molecular Constructor
Fc Ser78–Glu399

Human CD299-CLEC4M recombinant protein

There are no reviews yet.

Be the first to review “Human CD299-CLEC4M recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products