Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD307a-FCRL1 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q96LA6
Molecular weight:
33.94 kDa

$380.00

100ug + 380 loyalty points
Met1–Asn303 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD307a-FCRL1 recombinant protein

Product name Human CD307a-FCRL1 recombinant protein
Uniprot ID Q96LA6
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSN
Molecular weight 33.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn303
Aliases /Synonyms CD307a, Fc receptor homolog 1, hIFGP1, FcRL1, Fc receptor-like protein 1, FCRL1, IRTA5, IFGP family protein 1, FcR-like protein 1, FcRH1, Immune receptor translocation-associated protein 5, IFGP1, FCRH1
Reference PX-P6225
Note For research use only
Molecular Constructor
Met1–Asn303 His

Human CD307a-FCRL1 recombinant protein

There are no reviews yet.

Be the first to review “Human CD307a-FCRL1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products