Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD335/NCR1/NKp46 Monoclonal Antibody

  • ARO-A15881-50
  • Validated ELISA

Original price was: $340.00.Current price is: $275.00.

50ug 19% OFF + 275 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD335/NCR1/NKp46 Monoclonal Antibody

Product name ARO-A15881-100
Uniprot ID O76036
Uniprot link O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A15881
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD335/NCR1/NKp46
Clone Name NKp46-1
Protein Name CD335/NCR1/NKp46
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15881-1MG
Uniprot ID O76036
Uniprot link O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A15881
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD335/NCR1/NKp46
Clone Name NKp46-1
Protein Name CD335/NCR1/NKp46
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15881-50
Uniprot ID O76036
Uniprot link O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A15881
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD335/NCR1/NKp46
Clone Name NKp46-1
Protein Name CD335/NCR1/NKp46
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD335/NCR1/NKp46 Monoclonal Antibody

SEC-HPLC of Human CD335/NCR1/NKp46 Monoclonal Antibody

Human CD335/NCR1/NKp46 Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD335/NCR1/NKp46 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD335/NCR1/NKp46 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products