Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD337/NCR3 Monoclonal Antibody

Original price was: $330.00.Current price is: $275.00.

50ug 17% OFF + 275 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD337/NCR3 Monoclonal Antibody

Product name ARO-A15884-100
Uniprot ID O14931
Uniprot link O14931
Raw Antigen Sequence MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms NKp30, LY117, NCR3, 1C7, NK-p30, CD337, Natural cytotoxicity triggering receptor 3, Activating natural killer receptor p30, Natural killer cell p30-related protein
Reference ARO-A15884
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD337/NCR3
Clone Name BGA1831
Protein Name CD337/NCR3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15884-1MG
Uniprot ID O14931
Uniprot link O14931
Raw Antigen Sequence MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms NKp30, LY117, NCR3, 1C7, NK-p30, CD337, Natural cytotoxicity triggering receptor 3, Activating natural killer receptor p30, Natural killer cell p30-related protein
Reference ARO-A15884
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD337/NCR3
Clone Name BGA1831
Protein Name CD337/NCR3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15884-50
Uniprot ID O14931
Uniprot link O14931
Raw Antigen Sequence MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms NKp30, LY117, NCR3, 1C7, NK-p30, CD337, Natural cytotoxicity triggering receptor 3, Activating natural killer receptor p30, Natural killer cell p30-related protein
Reference ARO-A15884
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD337/NCR3
Clone Name BGA1831
Protein Name CD337/NCR3
Target species Anti-Human Monoclonal Antibody

Human CD337/NCR3 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD337/NCR3 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products