Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD34 Monoclonal Antibody

  • ARO-A15896-50
  • Validated ELISA FC

Original price was: $397.00.Current price is: $326.00.

50ug 18% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD34 Monoclonal Antibody

Product name ARO-A15896-100
Uniprot ID P28906
Uniprot link P28906
Raw Antigen Sequence MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD34, Hematopoietic progenitor cell antigen CD34
Reference ARO-A15896
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD34
Clone Name QBEND-10
Protein Name CD34
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15896-1MG
Uniprot ID P28906
Uniprot link P28906
Raw Antigen Sequence MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD34, Hematopoietic progenitor cell antigen CD34
Reference ARO-A15896
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD34
Clone Name QBEND-10
Protein Name CD34
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15896-50
Uniprot ID P28906
Uniprot link P28906
Raw Antigen Sequence MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD34, Hematopoietic progenitor cell antigen CD34
Reference ARO-A15896
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD34
Clone Name QBEND-10
Protein Name CD34
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD34 Monoclonal Antibody

SEC-HPLC of Human CD34 Monoclonal Antibody

Human CD34 Monoclonal Antibody(PX-TA1687) was analyzed by size exclusion chromatography with UV detection.

Flow Cytometry results for Human CD34 Monoclonal Antibody

Flow Cytometry results for Human CD34 Monoclonal Antibody

CD34 Transfected CHO cells were stained with an irrelevant antibody (Blue Histogram) or Human CD34 Monoclonal Antibody (ARO-A15896 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Mouse IgG Polyclonal Antibody, FITC (PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human CD34 Monoclonal Antibody

Flow Cytometry results for Human CD34 Monoclonal Antibody

KG-1 cells were stained with an irrelevant antibody (Blue Histogram) or Human CD34 Monoclonal Antibody (ARO-A15896 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Mouse IgG Polyclonal Antibody, FITC (PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Human CD34 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD34 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products