Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD368/CLEC4D Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q8WXI8
Molecular weight:
23.84 kDa

Original price was: $449.00.Current price is: $387.00.

100ug 14% OFF + 387 loyalty points
Cys39–Asn215 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD368/CLEC4D Recombinant Protein, C-His

Product name ARO-P20906-100
Uniprot ID Q8WXI8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Molecular weight 23.84 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys39-Asn215
Aliases /Synonyms C-type lectin domain family 4 member D, C-type lectin superfamily member 8, C-type lectin-like receptor 6, CD368, CLEC-6, CLEC4D, CLECSF8, DC-associated C-type lectin 3, Dectin-3, Dendritic cell-associated C-type lectin 3, MCL
Reference ARO-P20906
Note For research use only.
Molecular Constructor
Cys39–Asn215 His
Product name ARO-P20906-1MG
Uniprot ID Q8WXI8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Molecular weight 23.84 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys39-Asn215
Aliases /Synonyms C-type lectin domain family 4 member D, C-type lectin superfamily member 8, C-type lectin-like receptor 6, CD368, CLEC-6, CLEC4D, CLECSF8, DC-associated C-type lectin 3, Dectin-3, Dendritic cell-associated C-type lectin 3, MCL
Reference ARO-P20906
Note For research use only.
Molecular Constructor
Cys39–Asn215 His
Product name ARO-P20906-50
Uniprot ID Q8WXI8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Molecular weight 23.84 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys39-Asn215
Aliases /Synonyms C-type lectin domain family 4 member D, C-type lectin superfamily member 8, C-type lectin-like receptor 6, CD368, CLEC-6, CLEC4D, CLECSF8, DC-associated C-type lectin 3, Dectin-3, Dendritic cell-associated C-type lectin 3, MCL
Reference ARO-P20906
Note For research use only.
Molecular Constructor
Cys39–Asn215 His

There are no reviews yet.

Be the first to review “Human CD368/CLEC4D Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products