Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD369/CLEC7A Monoclonal Antibody

Original price was: $541.00.Current price is: $393.00.

100ug 27% OFF + 393 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD369/CLEC7A Monoclonal Antibody

Human CD369/CLEC7A Monoclonal Antibody

Product name ARO-A15807-100
Uniprot ID Q9BXN2
Uniprot link Q9BXN2
Raw Antigen Sequence MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Beta-glucan receptor, CD369, CLEC7A, DECTIN1, BGR, C-type lectin superfamily member 12, DC-associated C-type lectin 1, CLECSF12, Dectin-1, C-type lectin domain family 7 member A, Dendritic cell-associated C-type lectin 1
Reference ARO-A15807
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD369/CLEC7A
Clone Name 15E2#
Protein Name CD369/CLEC7A
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15807-1MG
Uniprot ID Q9BXN2
Uniprot link Q9BXN2
Raw Antigen Sequence MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Beta-glucan receptor, CD369, CLEC7A, DECTIN1, BGR, C-type lectin superfamily member 12, DC-associated C-type lectin 1, CLECSF12, Dectin-1, C-type lectin domain family 7 member A, Dendritic cell-associated C-type lectin 1
Reference ARO-A15807
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD369/CLEC7A
Clone Name 15E2#
Protein Name CD369/CLEC7A
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15807-50
Uniprot ID Q9BXN2
Uniprot link Q9BXN2
Raw Antigen Sequence MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Beta-glucan receptor, CD369, CLEC7A, DECTIN1, BGR, C-type lectin superfamily member 12, DC-associated C-type lectin 1, CLECSF12, Dectin-1, C-type lectin domain family 7 member A, Dendritic cell-associated C-type lectin 1
Reference ARO-A15807
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD369/CLEC7A
Clone Name 15E2#
Protein Name CD369/CLEC7A
Target species Anti-Human Monoclonal Antibody

Human CD369/CLEC7A Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD369/CLEC7A Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products